Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9BSL1 Ubiquitin-associated domain-containing protein 1 n=2 Tax=Homo sapiens TaxID=9606 RepID=UBAC1_HUMAN MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTSVEKLKERCLKHCAHGSLEDPKSITH HKLIHAASERVLSDARTILEENIQDQDVLLLIKKRAPSPLPKMADVSAEEKKKQDQKAPD KEAILRATANLPSYNMDRAAVQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKA NAMLDEDEDERVDEAALRQLTEMGFPENRATKALQLNHMSVPQAMEWLIEHAEDPTIDTP LPGQAPPEAEGATAAASEAAAGASATDEEARDELTEIFKKIRRKREFRADARAVISLMEM GFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAILDNPVVQLGL TNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9BSL1UBAC1_HUMANUbiquitin-associated domain-containing protein 1Homo sapiens (Human)9606405Representative & Seed
A0A140VK64A0A140VK64_HUMANTesticular secretory protein Li 64Homo sapiens (Human)9606405

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9BSL1

Checksumi: 5FC8EC84A8602CBE

FASTA40545,338
        10         20         30         40         50
MFVQEEKIFA GKVLRLHICA SDGAEWLEEA TEDTSVEKLK ERCLKHCAHG
60 70 80 90 100
SLEDPKSITH HKLIHAASER VLSDARTILE ENIQDQDVLL LIKKRAPSPL
110 120 130 140 150
PKMADVSAEE KKKQDQKAPD KEAILRATAN LPSYNMDRAA VQTNMRDFQT
160 170 180 190 200
ELRKILVSLI EVAQKLLALN PDAVELFKKA NAMLDEDEDE RVDEAALRQL
210 220 230 240 250
TEMGFPENRA TKALQLNHMS VPQAMEWLIE HAEDPTIDTP LPGQAPPEAE
260 270 280 290 300
GATAAASEAA AGASATDEEA RDELTEIFKK IRRKREFRAD ARAVISLMEM
310 320 330 340 350
GFDEKEVIDA LRVNNNQQNA ACEWLLGDRK PSPEELDKGI DPDSPLFQAI
360 370 380 390 400
LDNPVVQLGL TNPKTLLAFE DMLENPLNST QWMNDPETGP VMLQISRIFQ

TLNRT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again