Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9BX26 Synaptonemal complex protein 2 n=2 Tax=Homo sapiens TaxID=9606 RepID=SYCP2_HUMAN MPIRPDLQQLEKCIDDALRKNDFKPLKTLLQIDICEDVKIKCSKQFFHKVDNLICRELNK EDIHNVSAILVSVGRCGKNISVLGQAGLLTMIKQGLIQKMVAWFEKSKDIIQSQGNSKDE AVLNMIEDLVDLLLVIHDVSDEGKKQVVESFVPRICSLVIDSRVNICIQQEIIKKMNAML DKMPQDARKILSNQEMLILMSSMGERILDAGDYDLQVGIVEALCRMTTEKQRQELAHQWF SMDFIAKAFKRIKDSEFETDCRIFLNLVNGMLGDKRRVFTFPCLSAFLDKYELQIPSDEK LEEFWIDFNLGSQTLSFYIAGDNDDHQWEAVTVPEEKVQIYSIEVRESKKLLTIILKNTV KISKREGKELLLYFDASLEITNVTQKIFGATKHRESIRKQGISVAKTSLHILFDASGSQI LVPESQISPVGEELVSLKEKSKSPKEFAKPSKYIKNSDKGNRNNSQLEKTTPSKRKMSEA SMIVSGADRYTMRSPVLFSNTSIPPRRRRIKPPLQMTSSAEKPSVSQTSENRVDNAASLK SRSSEGRHRRDNIDKHIKTAKCVENTENKNVEFPNQNFSELQDVIPDSQAAEKRDHTILP GVLDNICGNKIHSKWACWTPVTNIELCNNQRASTSSGDTLNQDIVINKKLTKQKSSSSIS DHNSEGTGKVKYKKEQTDHIKIDKAEVEVCKKHNQQQNHPKYSGQKNTENAKQSDWPVES ETTFKSVLLNKTIEESLIYRKKYILSKDVNTATCDKNPSASKNVQSHRKAEKELTSELNS WDSKQKKMREKSKGKEFTNVAESLISQINKRYKTKDDIKSTRKLKESLINSGFSNKPVVQ LSKEKVQKKSYRKLKTTFVNVTSECPVNDVYNFNLNGADDPIIKLGIQEFQATAKEACAD RSIRLVGPRNHDELKSSVKTKDKKIITNHQKKNLFSDTETEYRCDDSKTDISWLREPKSK PQLIDYSRNKNVKNHKSGKSRSSLEKGQPSSKMTPSKNITKKMDKTIPEGRIRLPRKATK TKKNYKDLSNSESECEQEFSHSFKENIPVKEENIHSRMKTVKLPKKQQKVFCAETEKELS KQWKNSSLLKDAIRDNCLDLSPRSLSGSPSSIEVTRCIEKITEKDFTQDYDCITKSISPY PKTSSLESLNSNSGVGGTIKSPKNNEKNFLCASESCSPIPRPLFLPRHTPTKSNTIVNRK KISSLVLTQETQNSNSYSDVSSYSSEERFMEIESPHINENYIQSKREESHLASSLSKSSE GREKTWFDMPCDATHVSGPTQHLSRKRIYIEDNLSNSNEVEMEEKGERRANLLPKKLCKI EDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKM LSYFTTQSWKTAQQHLRTMNHQSQDSRIKKLDKFQFIIIEELENFEKDSQSLKDLEKEFV DFWEKIFQKFSAYQKSEQQRLHLLKTSLAKSVFCNTDSEETVFTSEMCLMKEDMKVLQDR LLKDMLEEELLNVRRELMSVFMSHERNANV

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9BX26SYCP2_HUMANSynaptonemal complex protein 2Homo sapiens (Human)96061,530Representative & Seed
A2A341A2A341_HUMANSynaptonemal complex protein 2 (Fragment)Homo sapiens (Human)96061,023

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9BX26

Checksumi: 3676EB133C53F1FA

FASTA1,530175,638
        10         20         30         40         50
MPIRPDLQQL EKCIDDALRK NDFKPLKTLL QIDICEDVKI KCSKQFFHKV
60 70 80 90 100
DNLICRELNK EDIHNVSAIL VSVGRCGKNI SVLGQAGLLT MIKQGLIQKM
110 120 130 140 150
VAWFEKSKDI IQSQGNSKDE AVLNMIEDLV DLLLVIHDVS DEGKKQVVES
160 170 180 190 200
FVPRICSLVI DSRVNICIQQ EIIKKMNAML DKMPQDARKI LSNQEMLILM
210 220 230 240 250
SSMGERILDA GDYDLQVGIV EALCRMTTEK QRQELAHQWF SMDFIAKAFK
260 270 280 290 300
RIKDSEFETD CRIFLNLVNG MLGDKRRVFT FPCLSAFLDK YELQIPSDEK
310 320 330 340 350
LEEFWIDFNL GSQTLSFYIA GDNDDHQWEA VTVPEEKVQI YSIEVRESKK
360 370 380 390 400
LLTIILKNTV KISKREGKEL LLYFDASLEI TNVTQKIFGA TKHRESIRKQ
410 420 430 440 450
GISVAKTSLH ILFDASGSQI LVPESQISPV GEELVSLKEK SKSPKEFAKP
460 470 480 490 500
SKYIKNSDKG NRNNSQLEKT TPSKRKMSEA SMIVSGADRY TMRSPVLFSN
510 520 530 540 550
TSIPPRRRRI KPPLQMTSSA EKPSVSQTSE NRVDNAASLK SRSSEGRHRR
560 570 580 590 600
DNIDKHIKTA KCVENTENKN VEFPNQNFSE LQDVIPDSQA AEKRDHTILP
610 620 630 640 650
GVLDNICGNK IHSKWACWTP VTNIELCNNQ RASTSSGDTL NQDIVINKKL
660 670 680 690 700
TKQKSSSSIS DHNSEGTGKV KYKKEQTDHI KIDKAEVEVC KKHNQQQNHP
710 720 730 740 750
KYSGQKNTEN AKQSDWPVES ETTFKSVLLN KTIEESLIYR KKYILSKDVN
760 770 780 790 800
TATCDKNPSA SKNVQSHRKA EKELTSELNS WDSKQKKMRE KSKGKEFTNV
810 820 830 840 850
AESLISQINK RYKTKDDIKS TRKLKESLIN SGFSNKPVVQ LSKEKVQKKS
860 870 880 890 900
YRKLKTTFVN VTSECPVNDV YNFNLNGADD PIIKLGIQEF QATAKEACAD
910 920 930 940 950
RSIRLVGPRN HDELKSSVKT KDKKIITNHQ KKNLFSDTET EYRCDDSKTD
960 970 980 990 1000
ISWLREPKSK PQLIDYSRNK NVKNHKSGKS RSSLEKGQPS SKMTPSKNIT
1010 1020 1030 1040 1050
KKMDKTIPEG RIRLPRKATK TKKNYKDLSN SESECEQEFS HSFKENIPVK
1060 1070 1080 1090 1100
EENIHSRMKT VKLPKKQQKV FCAETEKELS KQWKNSSLLK DAIRDNCLDL
1110 1120 1130 1140 1150
SPRSLSGSPS SIEVTRCIEK ITEKDFTQDY DCITKSISPY PKTSSLESLN
1160 1170 1180 1190 1200
SNSGVGGTIK SPKNNEKNFL CASESCSPIP RPLFLPRHTP TKSNTIVNRK
1210 1220 1230 1240 1250
KISSLVLTQE TQNSNSYSDV SSYSSEERFM EIESPHINEN YIQSKREESH
1260 1270 1280 1290 1300
LASSLSKSSE GREKTWFDMP CDATHVSGPT QHLSRKRIYI EDNLSNSNEV
1310 1320 1330 1340 1350
EMEEKGERRA NLLPKKLCKI EDADHHIHKM SESVSSLSTN DFSIPWETWQ
1360 1370 1380 1390 1400
NEFAGIEMTY ETYERLNSEF KRRNNIRHKM LSYFTTQSWK TAQQHLRTMN
1410 1420 1430 1440 1450
HQSQDSRIKK LDKFQFIIIE ELENFEKDSQ SLKDLEKEFV DFWEKIFQKF
1460 1470 1480 1490 1500
SAYQKSEQQR LHLLKTSLAK SVFCNTDSEE TVFTSEMCLM KEDMKVLQDR
1510 1520 1530
LLKDMLEEEL LNVRRELMSV FMSHERNANV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again