Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9H2Z4 Homeobox protein Nkx-2.4 n=5 Tax=Homininae TaxID=207598 RepID=NKX24_HUMAN MSLSPKHTTPFSVSDILSPIEETYKKFSGAMDGAPPGLGAPLGAAAAYRAPPPGPSSQAA TVAGMQPSHAMAGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHGAMGSYCNGGLGNMGE LPAYTDGMRGGAATGWYGANPDPRYSSISRFMGPSAGVNVAGMGSLTGIADAAKSLGPLH AAAAAAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNH RYKMKRQAKDKAAQQLQQEGGLGPPPPPPPSPRRVAVPVLVKDGKPCQNGASTPTPGQAG PQPPAPTPAPELEELSPSPPALHGPGGGLAALDAAAGEYSGGVLGANLLYGRTW

Members

Expand cluster to 90% or 50% identity.
1 to 5 of 5  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9H2Z4NKX24_HUMANHomeobox protein Nkx-2.4Homo sapiens (Human)9606354Representative & Seed
A2T6Y5A2T6Y5_PANTRNKX2-4 (Fragment)Pan troglodytes (Chimpanzee)9598130
A1YFZ6A1YFZ6_PANPANKX2-4 (Fragment)Pan paniscus (Pygmy chimpanzee) (Bonobo)9597130
A1YET0A1YET0_9PRIMNKX2-4 (Fragment)Gorilla gorilla (western gorilla)9593130
G3S4L1G3S4L1_GORGOHomeobox domain-containing proteinGorilla gorilla gorilla (Western lowland gorilla)9595203

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9H2Z4

Checksumi: A2A8963F9A2C5356

FASTA35436,179
        10         20         30         40         50
MSLSPKHTTP FSVSDILSPI EETYKKFSGA MDGAPPGLGA PLGAAAAYRA
60 70 80 90 100
PPPGPSSQAA TVAGMQPSHA MAGHNAAAAA AAAAAAAAAA ATYHMPPGVS
110 120 130 140 150
QFPHGAMGSY CNGGLGNMGE LPAYTDGMRG GAATGWYGAN PDPRYSSISR
160 170 180 190 200
FMGPSAGVNV AGMGSLTGIA DAAKSLGPLH AAAAAAAPRR KRRVLFSQAQ
210 220 230 240 250
VYELERRFKQ QKYLSAPERE HLASMIHLTP TQVKIWFQNH RYKMKRQAKD
260 270 280 290 300
KAAQQLQQEG GLGPPPPPPP SPRRVAVPVL VKDGKPCQNG ASTPTPGQAG
310 320 330 340 350
PQPPAPTPAP ELEELSPSPP ALHGPGGGLA ALDAAAGEYS GGVLGANLLY

GRTW
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again