Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9H5J8 TATA box-binding protein-associated factor RNA polymerase I subunit D n=4 Tax=Homininae TaxID=207598 RepID=TAF1D_HUMAN MDKSGIDSLDHVTSDAVELANRSDNSSDSSLFKTQCIPYSPKGEKRNPIRKFVRTPESVH ASDSSSDSSFEPIPLTIKAIFERFKNRKKRYKKKKKRRYQPTGRPRGRPEGRRNPIYSLI DKKKQFRSRGSGFPFLESENEKNAPWRKILTFEQAVARGFFNYIEKLKYEHHLKESLKQM NVGEDLENEDFDSRRYKFLDDDGSISPIEESTAEDEDATHLEDNECDIKLAGDSFIVSSE FPVRLSVYLEEEDITEEAALSKKRATKAKNTGQRGLKM

Members

Expand cluster to 90% or 50% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9H5J8TAF1D_HUMANTATA box-binding protein-associated factor RNA polymerase I subunit DHomo sapiens (Human)9606278Representative & Seed
A0A024R3A9A0A024R3A9_HUMANJosephin domain containing 3, isoform CRA_aHomo sapiens (Human)9606278
H0YG36H0YG36_HUMANTATA box-binding protein-associated factor RNA polymerase I subunit D (Fragment)Homo sapiens (Human)960642
A0A2J8L1S7A0A2J8L1S7_PANTRTAF1D isoform 13 (Fragment)Pan troglodytes (Chimpanzee)959842

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9H5J8

Checksumi: 4BA37C73BB387446

FASTA27832,058
        10         20         30         40         50
MDKSGIDSLD HVTSDAVELA NRSDNSSDSS LFKTQCIPYS PKGEKRNPIR
60 70 80 90 100
KFVRTPESVH ASDSSSDSSF EPIPLTIKAI FERFKNRKKR YKKKKKRRYQ
110 120 130 140 150
PTGRPRGRPE GRRNPIYSLI DKKKQFRSRG SGFPFLESEN EKNAPWRKIL
160 170 180 190 200
TFEQAVARGF FNYIEKLKYE HHLKESLKQM NVGEDLENED FDSRRYKFLD
210 220 230 240 250
DDGSISPIEE STAEDEDATH LEDNECDIKL AGDSFIVSSE FPVRLSVYLE
260 270
EEDITEEAAL SKKRATKAKN TGQRGLKM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again