Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9MIY5 ATP synthase subunit a n=2 Tax=Danio rerio TaxID=7955 RepID=ATP6_DANRE MMTSFFDQFASPYLLGIPLILVAMLLPWLLFPAPTSRWINNRLITVQTWLTGRFTNQLMT PLNFSGHKWALLFASLMVFLITINLLGLLPYTFTPTTQLSLNMGFAVPLWLATVIIGMKN QPTIALGHLLPEGTPIPLIPALIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAVF VLLPMMPAVAILTASVLFLLTLLEVAVAMIQAYVFILLLSLYLQENI

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9MIY5ATP6_DANREATP synthase subunit aDanio rerio (Zebrafish) (Brachydanio rerio)7955227Representative & Seed
A0A0A0VDB1A0A0A0VDB1_DANREATP synthase subunit aDanio rerio (Zebrafish) (Brachydanio rerio)7955227

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9MIY5

Checksumi: FE49495C77C8BCC4

FASTA22725,093
        10         20         30         40         50
MMTSFFDQFA SPYLLGIPLI LVAMLLPWLL FPAPTSRWIN NRLITVQTWL
60 70 80 90 100
TGRFTNQLMT PLNFSGHKWA LLFASLMVFL ITINLLGLLP YTFTPTTQLS
110 120 130 140 150
LNMGFAVPLW LATVIIGMKN QPTIALGHLL PEGTPIPLIP ALIIIETISL
160 170 180 190 200
FIRPLALGVR LTANLTAGHL LIQLIATAVF VLLPMMPAVA ILTASVLFLL
210 220
TLLEVAVAMI QAYVFILLLS LYLQENI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again