Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9NP79 Vacuolar protein sorting-associated protein VTA1 homolog n=4 Tax=Homininae TaxID=207598 RepID=VTA1_HUMAN MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFL SKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT ASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENED AGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHSTGVASNTIQ PTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALK LLTTGRE

Members

Expand cluster to 90% or 50% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9NP79VTA1_HUMANVacuolar protein sorting-associated protein VTA1 homologHomo sapiens (Human)9606307Representative & Seed
H2QTU7H2QTU7_PANTRVTA1 isoform 1Pan troglodytes (Chimpanzee)9598307
A0A2R9A2S5A0A2R9A2S5_PANPAVesicle trafficking 1Pan paniscus (Pygmy chimpanzee) (Bonobo)9597307
UPI00029DD288Vacuolar protein sorting-associated protein VTA1 homologHomo sapiens (Human)9606183

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9NP79

Checksumi: C7DE611E50B58BF9

FASTA30733,879
        10         20         30         40         50
MAALAPLPPL PAQFKSIQHH LRTAQEHDKR DPVVAYYCRL YAMQTGMKID
60 70 80 90 100
SKTPECRKFL SKLMDQLEAL KKQLGDNEAI TQEIVGCAHL ENYALKMFLY
110 120 130 140 150
ADNEDRAGRF HKNMIKSFYT ASLLIDVITV FGELTDENVK HRKYARWKAT
160 170 180 190 200
YIHNCLKNGE TPQAGPVGIE EDNDIEENED AGAASLPTQP TQPSSSSTYD
210 220 230 240 250
PSNMPSGNYT GIQIPPGAHA PANTPAEVPH STGVASNTIQ PTPQTIPAID
260 270 280 290 300
PALFNTISQG DVRLTPEDFA RAQKYCKYAG SALQYEDVST AVQNLQKALK

LLTTGRE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again