Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9NP84 Tumor necrosis factor receptor superfamily member 12A n=9 Tax=Catarrhini TaxID=9526 RepID=TNR12_HUMAN MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE GCPAVALIQ

Members

Expand cluster to 90% or 50% identity.
1 to 9 of 9  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9NP84TNR12_HUMANTumor necrosis factor receptor superfamily member 12AHomo sapiens (Human)9606129Representative & Seed
H2QAF0H2QAF0_PANTRTNF receptor superfamily member 12APan troglodytes (Chimpanzee)9598129
A0A096NL95A0A096NL95_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555129
A0A2R9AE22A0A2R9AE22_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597129
A0A0D9RD07A0A0D9RD07_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711129
A0A2K5ZEK5A0A2K5ZEK5_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568129
G3QR16G3QR16_GORGOUncharacterized proteinGorilla gorilla gorilla (Western lowland gorilla)9595129
A0A2K6C4S1A0A2K6C4S1_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545129
A0A2K5K2V6A0A2K5K2V6_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983129

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9NP84

Checksumi: BF3FDFB9C1E1C448

FASTA12913,911
        10         20         30         40         50
MARGSLRRLL RLLVLGLWLA LLRSVAGEQA PGTAPCSRGS SWSADLDKCM
60 70 80 90 100
DCASCRARPH SDFCLGCAAA PPAPFRLLWP ILGGALSLTF VLGLLSGFLV
110 120
WRRCRRREKF TTPIEETGGE GCPAVALIQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again