Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9NPH3 Interleukin-1 receptor accessory protein n=5 Tax=Hominidae TaxID=9604 RepID=IL1AP_HUMAN MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL LELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV

Members

Expand cluster to 90% or 50% identity.
1 to 5 of 5  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9NPH3IL1AP_HUMANInterleukin-1 receptor accessory proteinHomo sapiens (Human)9606570Representative & Seed
H2QNY9H2QNY9_PANTRIL1RAP isoform 1Pan troglodytes (Chimpanzee)9598570
A0A2J8WI11A0A2J8WI11_PONABIL1RAP isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601570
A0A2R8ZAI6A0A2R8ZAI6_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597570
UPI0007DC7A03interleukin-1 receptor accessory protein isoform X3Homo sapiens (Human)9606376

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9NPH3

Checksumi: 5F47F8D0ECA98B8A

FASTA57065,418
        10         20         30         40         50
MTLLWCVVSL YFYGILQSDA SERCDDWGLD TMRQIQVFED EPARIKCPLF
60 70 80 90 100
EHFLKFNYST AHSAGLTLIW YWTRQDRDLE EPINFRLPEN RISKEKDVLW
110 120 130 140 150
FRPTLLNDTG NYTCMLRNTT YCSKVAFPLE VVQKDSCFNS PMKLPVHKLY
160 170 180 190 200
IEYGIQRITC PNVDGYFPSS VKPTITWYMG CYKIQNFNNV IPEGMNLSFL
210 220 230 240 250
IALISNNGNY TCVVTYPENG RTFHLTRTLT VKVVGSPKNA VPPVIHSPND
260 270 280 290 300
HVVYEKEPGE ELLIPCTVYF SFLMDSRNEV WWTIDGKKPD DITIDVTINE
310 320 330 340 350
SISHSRTEDE TRTQILSIKK VTSEDLKRSY VCHARSAKGE VAKAAKVKQK
360 370 380 390 400
VPAPRYTVEL ACGFGATVLL VVILIVVYHV YWLEMVLFYR AHFGTDETIL
410 420 430 440 450
DGKEYDIYVS YARNAEEEEF VLLTLRGVLE NEFGYKLCIF DRDSLPGGIV
460 470 480 490 500
TDETLSFIQK SRRLLVVLSP NYVLQGTQAL LELKAGLENM ASRGNINVIL
510 520 530 540 550
VQYKAVKETK VKELKRAKTV LTVIKWKGEK SKYPQGRFWK QLQVAMPVKK
560 570
SPRRSSSDEQ GLSYSSLKNV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again