Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9NWZ3 Interleukin-1 receptor-associated kinase 4 n=8 Tax=Homo sapiens TaxID=9606 RepID=IRAK4_HUMAN MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS

Members

Expand cluster to 90% or 50% identity.
1 to 8 of 8  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9NWZ3IRAK4_HUMANInterleukin-1 receptor-associated kinase 4Homo sapiens (Human)9606460Representative & Seed
Q69FE3Q69FE3_HUMANInterleukin-1 receptor-associated kinase 4Homo sapiens (Human)9606460
Q9NWZ3-2Isoform 2 of IRAK4_HUMAN2Homo sapiens (Human)9606336
UPI0000F5344BInterleukin-1 receptor-associated kinase 4Homo sapiens (Human)9606301
UPI0000E9BBDFInterleukin-1 receptor-associated kinase 4Homo sapiens (Human)9606307
UPI000D671F27Interleukin-1 receptor-associated kinase 4Homo sapiens (Human)9606295
UPI000181CD7FInterleukin-1 receptor-associated kinase 4Homo sapiens (Human)9606298
UPI000F62C176297

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9NWZ3

Checksumi: 6C8156ADF25FF81E

FASTA46051,530
        10         20         30         40         50
MNKPITPSTY VRCLNVGLIR KLSDFIDPQE GWKKLAVAIK KPSGDDRYNQ
60 70 80 90 100
FHIRRFEALL QTGKSPTSEL LFDWGTTNCT VGDLVDLLIQ NEFFAPASLL
110 120 130 140 150
LPDAVPKTAN TLPSKEAITV QQKQMPFCDK DRTLMTPVQN LEQSYMPPDS
160 170 180 190 200
SSPENKSLEV SDTRFHSFSF YELKNVTNNF DERPISVGGN KMGEGGFGVV
210 220 230 240 250
YKGYVNNTTV AVKKLAAMVD ITTEELKQQF DQEIKVMAKC QHENLVELLG
260 270 280 290 300
FSSDGDDLCL VYVYMPNGSL LDRLSCLDGT PPLSWHMRCK IAQGAANGIN
310 320 330 340 350
FLHENHHIHR DIKSANILLD EAFTAKISDF GLARASEKFA QTVMTSRIVG
360 370 380 390 400
TTAYMAPEAL RGEITPKSDI YSFGVVLLEI ITGLPAVDEH REPQLLLDIK
410 420 430 440 450
EEIEDEEKTI EDYIDKKMND ADSTSVEAMY SVASQCLHEK KNKRPDIKKV
460
QQLLQEMTAS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again