Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9NYA1 Sphingosine kinase 1 n=4 Tax=Homo sapiens TaxID=9606 RepID=SPHK1_HUMAN MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW MVSGCVEPPPSWKPQQMPPPEEPL

Members

Expand cluster to 90% or 50% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9NYA1SPHK1_HUMANSphingosine kinase 1Homo sapiens (Human)9606384Representative
Q9NYA1-2Isoform 2 of SPHK1_HUMAN2Homo sapiens (Human)9606470Seed
Q53ZR5Q53ZR5_HUMANSphingosine kinase 1Homo sapiens (Human)9606384
Q9BTG7Q9BTG7_HUMANSPHK1 protein (Fragment)Homo sapiens (Human)9606287

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9NYA1

Checksumi: EB04A7F2034C2DB0

FASTA38442,518
        10         20         30         40         50
MDPAGGPRGV LPRPCRVLVL LNPRGGKGKA LQLFRSHVQP LLAEAEISFT
60 70 80 90 100
LMLTERRNHA RELVRSEELG RWDALVVMSG DGLMHEVVNG LMERPDWETA
110 120 130 140 150
IQKPLCSLPA GSGNALAASL NHYAGYEQVT NEDLLTNCTL LLCRRLLSPM
160 170 180 190 200
NLLSLHTASG LRLFSVLSLA WGFIADVDLE SEKYRRLGEM RFTLGTFLRL
210 220 230 240 250
AALRTYRGRL AYLPVGRVGS KTPASPVVVQ QGPVDAHLVP LEEPVPSHWT
260 270 280 290 300
VVPDEDFVLV LALLHSHLGS EMFAAPMGRC AAGVMHLFYV RAGVSRAMLL
310 320 330 340 350
RLFLAMEKGR HMEYECPYLV YVPVVAFRLE PKDGKGVFAV DGELMVSEAV
360 370 380
QGQVHPNYFW MVSGCVEPPP SWKPQQMPPP EEPL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again