Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9NZL9 Methionine adenosyltransferase 2 subunit beta n=12 Tax=Simiiformes TaxID=314293 RepID=MAT2B_HUMAN MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGF RRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNL AKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVL RIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRML DPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKL ETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH

Members

Expand cluster to 90% or 50% identity.
1 to 12 of 12  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9NZL9MAT2B_HUMANMethionine adenosyltransferase 2 subunit betaHomo sapiens (Human)9606334Representative & Seed
Q5R4E0MAT2B_PONABMethionine adenosyltransferase 2 subunit betaPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601334
A0A140VJP2A0A140VJP2_HUMANMethionine adenosyltransferase 2 subunit betaHomo sapiens (Human)9606334
F6RZ93F6RZ93_MACMUMethionine adenosyltransferase 2 subunit betaMacaca mulatta (Rhesus macaque)9544334
G2HHR9G2HHR9_PANTRMethionine adenosyltransferase 2 subunit betaPan troglodytes (Chimpanzee)9598334
U3EFG8U3EFG8_CALJAMethionine adenosyltransferase 2 subunit betaCallithrix jacchus (White-tufted-ear marmoset)9483334
A0A2J8X738A0A2J8X738_PONABMethionine adenosyltransferase 2 subunit betaPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601334
A0A2R9CM17A0A2R9CM17_PANPAMethionine adenosyltransferase 2 subunit betaPan paniscus (Pygmy chimpanzee) (Bonobo)9597334
A0A0D9RCY8A0A0D9RCY8_CHLSBMethionine adenosyltransferase 2 subunit betaChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711334
A0A2K5ZB17A0A2K5ZB17_MANLEMethionine adenosyltransferase 2 subunit betaMandrillus leucophaeus (Drill) (Papio leucophaeus)9568334
A0A2K5VAR3A0A2K5VAR3_MACFAMethionine adenosyltransferase 2 subunit betaMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541334
A0A2K6BUJ3A0A2K6BUJ3_MACNEMethionine adenosyltransferase 2 subunit betaMacaca nemestrina (Pig-tailed macaque)9545334

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9NZL9

Checksumi: 6AAA5381BAF3F65F

FASTA33437,552
        10         20         30         40         50
MVGREKELSI HFVPGSCRLV EEEVNIPNRR VLVTGATGLL GRAVHKEFQQ
60 70 80 90 100
NNWHAVGCGF RRARPKFEQV NLLDSNAVHH IIHDFQPHVI VHCAAERRPD
110 120 130 140 150
VVENQPDAAS QLNVDASGNL AKEAAAVGAF LIYISSDYVF DGTNPPYREE
160 170 180 190 200
DIPAPLNLYG KTKLDGEKAV LENNLGAAVL RIPILYGEVE KLEESAVTVM
210 220 230 240 250
FDKVQFSNKS ANMDHWQQRF PTHVKDVATV CRQLAEKRML DPSIKGTFHW
260 270 280 290 300
SGNEQMTKYE MACAIADAFN LPSSHLRPIT DSPVLGAQRP RNAQLDCSKL
310 320 330
ETLGIGQRTP FRIGIKESLW PFLIDKRWRQ TVFH
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again