Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9R0C0 Biogenesis of lysosome-related organelles complex 1 subunit 6 n=1 Tax=Mus musculus TaxID=10090 RepID=BL1S6_MOUSE MSVPEPPPPDGVLTGPSDSLEAGEPTPGLSDTSPDEGLIEDFPVDDRAVEHLVGGLLSHY LPDLQRSKRALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFTEAKHYHAKLVTIRK EMLLLHEKTSKLKKRALKLQQKRQREELEREQQREKEFEREKQLTAKPAKRT

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9R0C0BL1S6_MOUSEBiogenesis of lysosome-related organelles complex 1 subunit 6Mus musculus (Mouse)10090172Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9R0C0

Checksumi: 6B8068DF091B07D2

FASTA17219,682
        10         20         30         40         50
MSVPEPPPPD GVLTGPSDSL EAGEPTPGLS DTSPDEGLIE DFPVDDRAVE
60 70 80 90 100
HLVGGLLSHY LPDLQRSKRA LQELTQNQVV LLDTLEQEIS KFKECHSMLD
110 120 130 140 150
INALFTEAKH YHAKLVTIRK EMLLLHEKTS KLKKRALKLQ QKRQREELER
160 170
EQQREKEFER EKQLTAKPAK RT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again