Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q9UGP5 DNA polymerase lambda n=9 RepID=DPOLL_HUMAN MDPRGILKAFPKRQKIHADASSKVLAKIPRREEGEEAEEWLSSLRAHVVRTGIGRARAEL FEKQIVQHGGQLCPAQGPGVTHIVVDEGMDYERALRLLRLPQLPPGAQLVKSAWLSLCLQ ERRLVDVAGFSIFIPSRYLDHPQPSKAEQDASIPPGTHEALLQTALSPPPPPTRPVSPPQ KAKEAPNTQAQPISDDEASDGEETQVSAADLEALISGHYPTSLEGDCEPSPAPAVLDKWV CAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEAC SIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSL EDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLP GPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNT HGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Members

Expand cluster to 90% or 50% identity.
1 to 9 of 9  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q9UGP5DPOLL_HUMANDNA polymerase lambdaHomo sapiens (Human)9606575Representative & Seed
Q5ZEY5Q5ZEY5_HUMANDNA polymerase (Fragment)Homo sapiens (Human)9606167
Q5JQP8Q5JQP8_HUMANDNA polymeraseHomo sapiens (Human)9606487
B4DE17B4DE17_HUMANDNA polymeraseHomo sapiens (Human)9606267
UPI000771730FDNA polymerase lambdaHomo sapiens (Human)9606334
UPI0000358858DNA polymerase lambdaHomo sapiens (Human)9606331
UPI0007717322DNA polymerase lambdasynthetic construct32630327
UPI0007717338DNA polymerase lambdaHomo sapiens (Human)9606326
UPI0006DBD7A6DNA polymerase lambdaHomo sapiens (Human)9606325

Sequence

Representative sequenceiLengthMass (Da)Tools
Q9UGP5

Checksumi: FD9196A1C94923C4

FASTA57563,482
        10         20         30         40         50
MDPRGILKAF PKRQKIHADA SSKVLAKIPR REEGEEAEEW LSSLRAHVVR
60 70 80 90 100
TGIGRARAEL FEKQIVQHGG QLCPAQGPGV THIVVDEGMD YERALRLLRL
110 120 130 140 150
PQLPPGAQLV KSAWLSLCLQ ERRLVDVAGF SIFIPSRYLD HPQPSKAEQD
160 170 180 190 200
ASIPPGTHEA LLQTALSPPP PPTRPVSPPQ KAKEAPNTQA QPISDDEASD
210 220 230 240 250
GEETQVSAAD LEALISGHYP TSLEGDCEPS PAPAVLDKWV CAQPSSQKAT
260 270 280 290 300
NHNLHITEKL EVLAKAYSVQ GDKWRALGYA KAINALKSFH KPVTSYQEAC
310 320 330 340 350
SIPGIGKRMA EKIIEILESG HLRKLDHISE SVPVLELFSN IWGAGTKTAQ
360 370 380 390 400
MWYQQGFRSL EDIRSQASLT TQQAIGLKHY SDFLERMPRE EATEIEQTVQ
410 420 430 440 450
KAAQAFNSGL LCVACGSYRR GKATCGDVDV LITHPDGRSH RGIFSRLLDS
460 470 480 490 500
LRQEGFLTDD LVSQEENGQQ QKYLGVCRLP GPGRRHRRLD IIVVPYSEFA
510 520 530 540 550
CALLYFTGSA HFNRSMRALA KTKGMSLSEH ALSTAVVRNT HGCKVGPGRV
560 570
LPTPTEKDVF RLLGLPYREP AERDW
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again