Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_U3BQE8 Interleukin-1 receptor-associated kinase 1 isoform 2 n=1 Tax=Callithrix jacchus TaxID=9483 RepID=U3BQE8_CALJA MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPSTTAPRPSC IPAPAETEACSPRKLPSSASTLLSPAFPGSQTHSGPELGLVPSPASLRSPLPSPAPSSTK PESSESSVSLLQGAHPSPFCWPLCEISQGTHDFSEELKIGEGGFGCVYRAVMRNTVYAVK RLKEDAGLEWSAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDR LHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDF GLARFSRFAGASPSQSSTVARTRTVQGTLAYLPEEYIKTGRLSVDTDTFSFGVVVLETLA GQRAVKMHGARTKYLKDLVEEEAEEAGVALRSTQTALQAALAADAWATPIAIQIYKKHLD PRPGPCPPELGLGLGRLACCCLHRRAKRRPPMTQENSYVSSTGSAHSGAAPLQPLAAPSG ASAQAAEQFQRGPNQPVESDESLCGLSAALRSWHLTPSCPLGPAPLREAGCPQGDTAGEL SWRSGPGFRTAATEGLALGSSASSSEPPQIVINPARQKMVQKLALYEDGALDSLQLLSSS FFPGLGLEQDRQGPEESDEFQS

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
U3BQE8U3BQE8_CALJAInterleukin-1 receptor-associated kinase 1 isoform 2Callithrix jacchus (White-tufted-ear marmoset)9483682Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
U3BQE8

Checksumi: 26E2380030600ED5

FASTA68273,400
        10         20         30         40         50
MAGGPGPGEP AAPGAQHFLY EVPPWVMCRF YKVMDALEPA DWCQFAALIV
60 70 80 90 100
RDQTELRLCE RSGQRTASVL WPWINRNARV ADLVHILTHL QLLRARDIIT
110 120 130 140 150
AWHPPAPLPS PSTTAPRPSC IPAPAETEAC SPRKLPSSAS TLLSPAFPGS
160 170 180 190 200
QTHSGPELGL VPSPASLRSP LPSPAPSSTK PESSESSVSL LQGAHPSPFC
210 220 230 240 250
WPLCEISQGT HDFSEELKIG EGGFGCVYRA VMRNTVYAVK RLKEDAGLEW
260 270 280 290 300
SAVKQSFLTE VEQLSRFRHP NIVDFAGYCA QNGFYCLVYG FLPNGSLEDR
310 320 330 340 350
LHCQTQACPP LSWPQRLDIL LGTARAIQFL HQDSPSLIHG DIKSSNVLLD
360 370 380 390 400
ERLTPKLGDF GLARFSRFAG ASPSQSSTVA RTRTVQGTLA YLPEEYIKTG
410 420 430 440 450
RLSVDTDTFS FGVVVLETLA GQRAVKMHGA RTKYLKDLVE EEAEEAGVAL
460 470 480 490 500
RSTQTALQAA LAADAWATPI AIQIYKKHLD PRPGPCPPEL GLGLGRLACC
510 520 530 540 550
CLHRRAKRRP PMTQENSYVS STGSAHSGAA PLQPLAAPSG ASAQAAEQFQ
560 570 580 590 600
RGPNQPVESD ESLCGLSAAL RSWHLTPSCP LGPAPLREAG CPQGDTAGEL
610 620 630 640 650
SWRSGPGFRT AATEGLALGS SASSSEPPQI VINPARQKMV QKLALYEDGA
660 670 680
LDSLQLLSSS FFPGLGLEQD RQGPEESDEF QS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again