Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_U3TEW2 Glycerol-1-phosphate dehydrogenase [NAD(P)+] n=2 Tax=Aeropyrum camini TaxID=229980 RepID=U3TEW2_9CREN MSFHRIDLPRTIVVGGGVLDKAGSYISGVAQRGSYVLVVSGHTVSSRYFERLRASLEAEG LTVGLKIVRDASVETAEEVAREAAESRIDVVAGLGGGKSIDVAKYASKRSGAVFISIPTV ASHDGITSPFSSLKGFGKPISRPAKAPDAIIIDVDVIAEAPRRYNIAGFGDLIGKYTAVL DWRLAHKLRLEYYGEYAASLALLSAKHVSQYAEEIALGTREGYRVLLEALVSSGVSMCIA GSTRPASGSEHLFAHALHIVARNKPLHGEAVGVGTIMMAYLHGKNWRRIRGLLKTVGAPT NARELGVTEDEVVEALTIAARIRPERYTILGEKGLTREAAEALARKTGVI

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
U3TEW2U3TEW2_9CRENGlycerol-1-phosphate dehydrogenase [NAD(P)+]Aeropyrum camini SY1 = JCM 120911198449350Representative
UPI0009EACF68NAD(P)-dependent glycerol-1-phosphate dehydrogenaseAeropyrum camini229980352Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
U3TEW2

Checksumi: 9C2593635AF686B8

FASTA35037,387
        10         20         30         40         50
MSFHRIDLPR TIVVGGGVLD KAGSYISGVA QRGSYVLVVS GHTVSSRYFE
60 70 80 90 100
RLRASLEAEG LTVGLKIVRD ASVETAEEVA REAAESRIDV VAGLGGGKSI
110 120 130 140 150
DVAKYASKRS GAVFISIPTV ASHDGITSPF SSLKGFGKPI SRPAKAPDAI
160 170 180 190 200
IIDVDVIAEA PRRYNIAGFG DLIGKYTAVL DWRLAHKLRL EYYGEYAASL
210 220 230 240 250
ALLSAKHVSQ YAEEIALGTR EGYRVLLEAL VSSGVSMCIA GSTRPASGSE
260 270 280 290 300
HLFAHALHIV ARNKPLHGEA VGVGTIMMAY LHGKNWRRIR GLLKTVGAPT
310 320 330 340 350
NARELGVTED EVVEALTIAA RIRPERYTIL GEKGLTREAA EALARKTGVI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again