Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_UPI00032ADA7A biogenesis of lysosome-related organelles complex 1 subunit 6 n=1 Tax=Ochotona princeps TaxID=9978 RepID=UPI00032ADA7A MSVPGPQSPDGGLPGPPGSLEVRELMPGLSDASPDEGLIEDLSVEDRAVEQLAEGLLSHY LPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFTEAKHYHAKLVNIRK EMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTAKPAKRT

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
UPI00032ADA7Abiogenesis of lysosome-related organelles complex 1 subunit 6Ochotona princeps (Southern American pika)9978172Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
UPI00032ADA7A

Checksumi: 6760BC455F05EEF1

FASTA17219,661
        10         20         30         40         50
MSVPGPQSPD GGLPGPPGSL EVRELMPGLS DASPDEGLIE DLSVEDRAVE
60 70 80 90 100
QLAEGLLSHY LPDLQRSKQA LQELTQNQVV LLDTLEQEIS KFKECHSMLD
110 120 130 140 150
INALFTEAKH YHAKLVNIRK EMLMLHEKTS KLKKRALKLQ QKRQKEELER
160 170
EQQREKEFER EKQLTAKPAK RT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again