Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A0A0A7HMS2 Conidiophore development regulator abaA n=20 Tax=Hypocreales TaxID=5125 RepID=ABAA_ACRCH MSSSSSQSSLYQPRPVLSSQRFSPAPDYIDTRRSFHGDSRLPLRESTGNVQQQHHHQEPS SAHSSFNGGSLVGCYQTPVTLSPSMQSSIPPPAPIVPSQSFDCLRSLQATTSRQHHHVPP PLPQVPTRYHQRGKPRNSINPLYFWPAFRQYRNRQAHKDTQKDKGGVWRRPELEDAFVDS VLLMPHMGRRKFSMGGKLHGRNMLISEYIFVICVALLGSKEIFRIDNSNDSIEQMGRKQV SSHMQVVKKFFEDLRCFHFLFPSEEKKEPGTTNSDDFYEEEEQESFKSNPVLTALAEGRV PDVRPNYEYFSQLLALQSSITVRPKTVEIFVSSADVKIRDEVAYDANDNPLDPASFPHLG KYMNSSGDDKPNVLGKDVLLHEYTRSLDRSTSACVKTVTRRWQRDAPAMYDSLDLPDRDE DCLLLEMCSTVDLHEHAKFPSGSELTGYVEVSVTQPALQGHRWKCVTRLTRPPELQTDEG RPEMYSNESGIHRRGCADTRHEDCGCHLRPRQDIHVPFPAVEWASILSMAVQYPDVEHQR KKEKRSCGKKPDLERSASSSKRKRSEDEGDAAAWTRREPTGSDLICKVAMYQELWSCAPD STRWTRQAIIFWRFSTTNQWYKYNPVFRPAGTTWRWLTVNDPMSRYHQQRALVYPSAGGN NMPRDAVMSPTPSVSQHLTATMSENFSQAWDSSGSNVTTHTQVHVAGGGGGGGSNMTTLF DSFPSGLATPPPTASLHGSYSASGSFDAGNGVGGCYMPPTCGGGADGPHGGLPAPSQSYF DAAGQTVNTTFGDVKPLLSGSATNPYLPGAAGGGGTGSLDLSGQFAYDDGQQHQHQHQHQ QHQQQNHNGGSNGGLPGWDMGPALDSWTAGSSAGGAPAATPTGPDWGPTAPVPRMTEHHP GMWDPVHWSNHGTPGRGGEGSPRQMKRRRTEVLVDGVPVTAGW

Members

List component clusters with 100% or 90% identity.
1 to 20 of 20  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A0A7HMS2ABAA_ACRCHConidiophore development regulator abaAAcremonium chrysogenum (Cephalosporium acremonium)5044UniRef100_A0A0A7HMS2
UniRef90_A0A0A7HMS2
943Representative
A0A086T850A0A086T850_ACRC1Regulatory protein-like proteinAcremonium chrysogenum (strain ATCC 11550 / CBS 779.69 / DSM 880 / JCM 23072 / IMI 49137)857340UniRef100_A0A0A7HMS2
UniRef90_A0A0A7HMS2
943
M1W0P6M1W0P6_CLAP2TEA domain-containing proteinClaviceps purpurea (strain 20.1) (Ergot fungus) (Sphacelia segetum)1111077UniRef100_M1W0P6
UniRef90_M1W0P6
900
A0A2C5Y0U3A0A2C5Y0U3_9HYPOTEA domain-containing proteinOphiocordyceps australis1399860UniRef100_A0A2C5Y0U3
UniRef90_A0A2C5Y0U3
930
A0A2C5YE62A0A2C5YE62_9HYPOTEA domain-containing proteinOphiocordyceps australis1399860UniRef100_A0A2C5YE62
UniRef90_A0A2C5Y0U3
917
A0A167J264A0A167J264_9HYPOTranscription factor AbaACordyceps fumosorosea ARSEF 26791081104UniRef100_A0A167J264
UniRef90_A0A167J264
911
A0A3B8DUU2A0A3B8DUU2_9HYPOTranscription factor AbaAPurpureocillium lavendulum1247861UniRef100_A0A3B8DUU2
UniRef90_A0A2U3EFV1
915
A0A2U3EFV1A0A2U3EFV1_PURLITEA domain-containing proteinPurpureocillium lilacinum (Paecilomyces lilacinus)33203UniRef100_A0A2U3EFV1
UniRef90_A0A2U3EFV1
1,124Seed
A0A179GZR2A0A179GZR2_PURLITranscription factor AbaAPurpureocillium lilacinum (Paecilomyces lilacinus)33203UniRef100_A0A2U3EFV1
UniRef90_A0A2U3EFV1
888
A0A179IBZ4A0A179IBZ4_CORDFTEA domain-containing protein (Fragment)Cordyceps confragosa (Lecanicillium lecanii)1105325UniRef100_A0A179IBZ4
UniRef90_A0A179IBZ4
755
A0A168KFX0A0A168KFX0_CORDFTranscription factor AbaACordyceps confragosa RCEF 10051081108UniRef100_A0A168KFX0
UniRef90_A0A179IBZ4
906
A0A0A2VVW1A0A0A2VVW1_BEABARegulatory protein abaABeauveria bassiana D1-51245745UniRef100_A0A0A2VVW1
UniRef90_A0A2S7Y512
901
A0A167EX61A0A167EX61_9HYPOTranscription factor AbaABeauveria brongniartii RCEF 31721081107UniRef100_A0A167EX61
UniRef90_A0A2S7Y512
906
J4WLR8J4WLR8_BEAB2FoabaA-like proteinBeauveria bassiana (strain ARSEF 2860) (White muscardine disease fungus) (Tritirachium shiotae)655819UniRef100_J4WLR8
UniRef90_A0A2S7Y512
901
A0A2N6NF91A0A2N6NF91_BEABAConidiophore development regulator abaABeauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae)176275UniRef100_A0A2N6NF91
UniRef90_A0A2S7Y512
900
A0A2S7Y512A0A2S7Y512_BEABATEA domain-containing proteinBeauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae)176275UniRef100_A0A2S7Y512
UniRef90_A0A2S7Y512
900
G3JJP6G3JJP6_CORMMTranscription factor AbaACordyceps militaris (strain CM01) (Caterpillar fungus)983644UniRef100_G3JJP6
UniRef90_G3JJP6
938
A0A2H4S6A7A0A2H4S6A7_CORMITranscription factorCordyceps militaris (Caterpillar fungus) (Clavaria militaris)73501UniRef100_A0A2H4S6A7
UniRef90_G3JJP6
918
A0A0M8N3Q6A0A0M8N3Q6_9HYPORegulatory protein abaAEscovopsis weberi150374UniRef100_A0A0M8N3Q6
UniRef90_A0A0M8N3Q6
936
A0A545W746A0A545W746_9HYPOTranscription factor AbaACordyceps javanica43265UniRef100_A0A545W746
UniRef90_A0A545W746
901

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A0A7HMS2

Checksumi: EB0B7267B9FD5797

FASTA943104,145
        10         20         30         40         50
MSSSSSQSSL YQPRPVLSSQ RFSPAPDYID TRRSFHGDSR LPLRESTGNV
60 70 80 90 100
QQQHHHQEPS SAHSSFNGGS LVGCYQTPVT LSPSMQSSIP PPAPIVPSQS
110 120 130 140 150
FDCLRSLQAT TSRQHHHVPP PLPQVPTRYH QRGKPRNSIN PLYFWPAFRQ
160 170 180 190 200
YRNRQAHKDT QKDKGGVWRR PELEDAFVDS VLLMPHMGRR KFSMGGKLHG
210 220 230 240 250
RNMLISEYIF VICVALLGSK EIFRIDNSND SIEQMGRKQV SSHMQVVKKF
260 270 280 290 300
FEDLRCFHFL FPSEEKKEPG TTNSDDFYEE EEQESFKSNP VLTALAEGRV
310 320 330 340 350
PDVRPNYEYF SQLLALQSSI TVRPKTVEIF VSSADVKIRD EVAYDANDNP
360 370 380 390 400
LDPASFPHLG KYMNSSGDDK PNVLGKDVLL HEYTRSLDRS TSACVKTVTR
410 420 430 440 450
RWQRDAPAMY DSLDLPDRDE DCLLLEMCST VDLHEHAKFP SGSELTGYVE
460 470 480 490 500
VSVTQPALQG HRWKCVTRLT RPPELQTDEG RPEMYSNESG IHRRGCADTR
510 520 530 540 550
HEDCGCHLRP RQDIHVPFPA VEWASILSMA VQYPDVEHQR KKEKRSCGKK
560 570 580 590 600
PDLERSASSS KRKRSEDEGD AAAWTRREPT GSDLICKVAM YQELWSCAPD
610 620 630 640 650
STRWTRQAII FWRFSTTNQW YKYNPVFRPA GTTWRWLTVN DPMSRYHQQR
660 670 680 690 700
ALVYPSAGGN NMPRDAVMSP TPSVSQHLTA TMSENFSQAW DSSGSNVTTH
710 720 730 740 750
TQVHVAGGGG GGGSNMTTLF DSFPSGLATP PPTASLHGSY SASGSFDAGN
760 770 780 790 800
GVGGCYMPPT CGGGADGPHG GLPAPSQSYF DAAGQTVNTT FGDVKPLLSG
810 820 830 840 850
SATNPYLPGA AGGGGTGSLD LSGQFAYDDG QQHQHQHQHQ QHQQQNHNGG
860 870 880 890 900
SNGGLPGWDM GPALDSWTAG SSAGGAPAAT PTGPDWGPTA PVPRMTEHHP
910 920 930 940
GMWDPVHWSN HGTPGRGGEG SPRQMKRRRT EVLVDGVPVT AGW
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again