Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A0A166KGY3 Glycosyltransferase family 69 protein n=147 Tax=Agaricomycotina TaxID=5302 RepID=A0A166KGY3_9AGAM MQPKTPYSRGPLAFTQRIPTPLAVLIGIFIGAVLMRLSGFTSSSLPSTTSAWKGNHLPSY ATGGSTSSRHTVPLPSTDQRRRVLDLLTTLSPRYTRECTRPANPLYAQQVRERYAPLIGH NPSSSKSWLSGLGLGGLDALPGPSQEEVNYYQHRRDLSGGEHKYFFAINLYNSFDIIPDL FSTLFRVGAVLGYHNVFVSIYENGSSDQTKALLRVFDALTRSVGMRFVIRTSQRTRGAFN HRIEYLAEVRNSAFVPLHELREAENEYFDTIIFMNDVLPCVDDLLELIWQSRHNNAGITC AADYMFHDELGAPVFYDNWVARDINGTALENAPFEQVFHHSNSAERFQRHLPIQVQSCWN GIAVMDPEPFYTPPSVRFRMARIADGECSASECSLICNDYWEKGFGRILMVPRVKLAYDS KVFDIIHPSRRNLTSIRGYVRLGGLPDNPRTDPQDRSWFGPHDRLFTEEESEALDFVPGP EHVWCWGWDGAGDLDGPDVDPIWEAVASQAVGPNPVQIRHRRDFK

Members

List component clusters with 100% or 90% identity.
1 to 25 of 147  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A166KGY3A0A166KGY3_9AGAMGlycosyltransferase family 69 proteinPeniophora sp. CONT1314672UniRef100_A0A166KGY3
UniRef90_A0A166KGY3
525Representative
A0A401GMQ5A0A401GMQ5_9APHYAlpha-1,3-mannosyltransferase CMT1Sparassis crispa139825UniRef100_A0A401GMQ5
UniRef90_A0A401GMQ5
504
A0A067T3N0A0A067T3N0_GALM3Uncharacterized proteinGalerina marginata (strain CBS 339.88)685588UniRef100_A0A067T3N0
UniRef90_A0A067T3N0
506
A0A165B5E8A0A165B5E8_EXIGLCAP59-like proteinExidia glandulosa HHB120291314781UniRef100_A0A165B5E8
UniRef90_A0A165B5E8
517
S8DSY7S8DSY7_FOMPIUncharacterized proteinFomitopsis pinicola (strain FP-58527) (Brown rot fungus)743788UniRef100_S8DSY7
UniRef90_A0A165LY63
511
A0A165LY63A0A165LY63_9APHYGlycosyltransferase family 69 proteinDaedalea quercina L-158891314783UniRef100_A0A165LY63
UniRef90_A0A165LY63
508
A0A165BCA7A0A165BCA7_9APHYGlycosyltransferase family 69 proteinLaetiporus sulphureus 93-531314785UniRef100_A0A165BCA7
UniRef90_A0A165LY63
445
J4G6S8J4G6S8_9APHYUncharacterized proteinFibroporia radiculosa599839UniRef100_J4G6S8
UniRef90_A0A165LY63
416
A0A1Y2B9T6A0A1Y2B9T6_9TREECryptococcal mannosyltransferase 1-domain-containing proteinNaematelia encephala71784UniRef100_A0A1Y2B9T6
UniRef90_A0A1Y2B9T6
522
A0A0H2RDS3A0A0H2RDS3_9AGAMCapsular associated proteinSchizopora paradoxa27342UniRef100_A0A0H2RDS3
UniRef90_A0A0H2RDS3
520
A0A409XLK4A0A409XLK4_PSICYUncharacterized proteinPsilocybe cyanescens93625UniRef100_A0A409XLK4
UniRef90_A0A0C3BI42
523
A0A409VV28A0A409VV28_9AGARUncharacterized proteinGymnopilus dilepis231916UniRef100_A0A409VV28
UniRef90_A0A0C3BI42
507
A0A0C3BI42A0A0C3BI42_HEBCYGlycosyltransferase family 69 proteinHebeloma cylindrosporum h7686832UniRef100_A0A0C3BI42
UniRef90_A0A0C3BI42
504
A0A0C3B8X5A0A0C3B8X5_9AGAMGlycosyltransferase family 69 proteinPiloderma croceum F 1598765440UniRef100_A0A0C3B8X5
UniRef90_A0A0C3B8X5
515
A0A166JWM0A0A166JWM0_9AGAMGlycosyltransferase family 69 proteinFibularhizoctonia sp. CBS 109695436010UniRef100_A0A166JWM0
UniRef90_A0A166JWM0
513
A0A146I0D9A0A146I0D9_9AGARUncharacterized proteinMycena chlorophos658473UniRef100_A0A146I0D9
UniRef90_A0A146I0D9
508
A0A2A9NC94A0A2A9NC94_9AGARGlycosyltransferase family 69 proteinAmanita thiersii Skay4041703135UniRef100_A0A2A9NC94
UniRef90_A0A2A9NC94
515
A0A427XQR8A0A427XQR8_9TREECapsular associated proteinApiotrichum porosum105984UniRef100_A0A427XQR8
UniRef90_A0A427XQR8
533
A0A0F7SF22A0A0F7SF22_PHARHMannosyltransferase 1, CMT1Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous)5421UniRef100_A0A0F7SF22
UniRef90_A0A0F7SF22
531
B0DMG9B0DMG9_LACBSCAP59-like proteinLaccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor)486041UniRef100_B0DMG9
UniRef90_A0A0C9XAX3
444
A0A0C9XAX3A0A0C9XAX3_9AGARUnplaced genomic scaffold K443scaffold_130, whole genome shotgun sequenceLaccaria amethystina LaAM-08-11095629UniRef100_A0A0C9XAX3
UniRef90_A0A0C9XAX3
507
A0A060STE7A0A060STE7_PYCCIGlycosyltransferase Family 69 proteinPycnoporus cinnabarinus (Cinnabar-red polypore) (Trametes cinnabarina)5643UniRef100_A0A060STE7
UniRef90_A0A060STE7
506
A0A371D041A0A371D041_9APHYGlycosyltransferase family 69 proteinPolyporus brumalis139420UniRef100_A0A371D041
UniRef90_A0A060STE7
506
A0A1Y2IH83A0A1Y2IH83_PYCCOGlycosyltransferase family 69 proteinTrametes coccinea BRFM3101353009UniRef100_A0A1Y2IH83
UniRef90_A0A060STE7
506
A0A1M2VEF4A0A1M2VEF4_TRAPUAlpha-1,3-mannosyltransferase CMT1Trametes pubescens (White-rot fungus)154538UniRef100_A0A1M2VEF4
UniRef90_A0A060STE7
415

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A166KGY3

Checksumi: 57AEAA66FDABA1BE

FASTA52559,329
        10         20         30         40         50
MQPKTPYSRG PLAFTQRIPT PLAVLIGIFI GAVLMRLSGF TSSSLPSTTS
60 70 80 90 100
AWKGNHLPSY ATGGSTSSRH TVPLPSTDQR RRVLDLLTTL SPRYTRECTR
110 120 130 140 150
PANPLYAQQV RERYAPLIGH NPSSSKSWLS GLGLGGLDAL PGPSQEEVNY
160 170 180 190 200
YQHRRDLSGG EHKYFFAINL YNSFDIIPDL FSTLFRVGAV LGYHNVFVSI
210 220 230 240 250
YENGSSDQTK ALLRVFDALT RSVGMRFVIR TSQRTRGAFN HRIEYLAEVR
260 270 280 290 300
NSAFVPLHEL REAENEYFDT IIFMNDVLPC VDDLLELIWQ SRHNNAGITC
310 320 330 340 350
AADYMFHDEL GAPVFYDNWV ARDINGTALE NAPFEQVFHH SNSAERFQRH
360 370 380 390 400
LPIQVQSCWN GIAVMDPEPF YTPPSVRFRM ARIADGECSA SECSLICNDY
410 420 430 440 450
WEKGFGRILM VPRVKLAYDS KVFDIIHPSR RNLTSIRGYV RLGGLPDNPR
460 470 480 490 500
TDPQDRSWFG PHDRLFTEEE SEALDFVPGP EHVWCWGWDG AGDLDGPDVD
510 520
PIWEAVASQA VGPNPVQIRH RRDFK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again