Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A0A1D5QD61 Ribosomal_L28e domain-containing protein n=22 Tax=Euteleostomi TaxID=117571 RepID=A0A1D5QD61_MACMU MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGV VVVIKRRSE

Members

List component clusters with 100% or 90% identity.
1 to 22 of 22  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A1D5QD61A0A1D5QD61_MACMURibosomal_L28e domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69Representative
A0A2J8R3F9A0A2J8R3F9_PONABRPL28 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2J8IWU0A0A2J8IWU0_PANTRRPL28 isoform 9Pan troglodytes (Chimpanzee)9598UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2K5LPJ1A0A2K5LPJ1_CERATRibosomal_L28e domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2K6NXH5A0A2K6NXH5_RHIRORibosomal_L28e domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2I3NGR7A0A2I3NGR7_PAPANRibosomal_L28e domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2R9BKX1A0A2R9BKX1_PANPARibosomal_L28e domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2K5ZSX5A0A2K5ZSX5_MANLERibosomal_L28e domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2I3H156A0A2I3H156_NOMLERibosomal_L28e domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2I2ZF02A0A2I2ZF02_GORGORibosomal protein L28Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2K5VDV5A0A2K5VDV5_MACFARibosomal_L28e domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2K6LCT8A0A2K6LCT8_RHIBERibosomal_L28e domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2K6C1K6A0A2K6C1K6_MACNERibosomal_L28e domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
P46779-4Isoform 4 of RL28_HUMAN4Homo sapiens (Human)9606UniRef100_A0A1D5QD61
UniRef90_A0A1D5QD61
69
A0A2K6FAM8A0A2K6FAM8_PROCORibosomal_L28e domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6FAM8
UniRef90_A0A2K6FAM8
69
A0A2K6TVJ9A0A2K6TVJ9_SAIBBRibosomal protein L28Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6FAM8
UniRef90_A0A2K6FAM8
69
A0A2K5QJB1A0A2K5QJB1_CEBCARibosomal_L28e domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K6FAM8
UniRef90_A0A2K6FAM8
69
A0A2K5EKK9A0A2K5EKK9_AOTNARibosomal_L28e domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K6FAM8
UniRef90_A0A2K6FAM8
69
A0A485MQI2A0A485MQI2_LYNPARibosomal protein l28Lynx pardinus (Iberian lynx) (Felis pardina)191816UniRef100_A0A485MQI2
UniRef90_A0A485MQI2
71Seed
Q4TBX4Q4TBX4_TETNGChromosome undetermined SCAF7082, whole genome shotgun sequence (Fragment)Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)99883UniRef100_Q4TBX4
UniRef90_Q4TBX4
70
A0A4U1FFR5A0A4U1FFR5_MONMORibosomal_L28e domain-containing proteinMonodon monoceros (Narwhal) (Ceratodon monodon)40151UniRef100_A0A4U1FFR5
UniRef90_A0A4U1FFR5
66
UPI000DF40D9A60S ribosomal protein L28 isoform X2Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)8128UniRef100_UPI000DF40D9A
UniRef90_Q4TBX4
70

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A1D5QD61

Checksumi: EDE20EE54DFE31FE

FASTA697,888
        10         20         30         40         50
MSAHLQWMVV RNCSSFLIKR NKQTYSTEPN NLKARNSFRY NGLIHRKTVG
60
VEPAADGKGV VVVIKRRSE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again