Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A0A286ZMX5 Uncharacterized protein n=17 Tax=Bilateria TaxID=33213 RepID=A0A286ZMX5_PIG KPPKIKKKKKKDAGKSAKKDKDPVNKSGGKAQKKKWSKGKVWDKLNNLVSFDKLIIPAII SERLKIRGSLARAALQKLLSKGLIKLVSKHRAQVIYT

Members

List component clusters with 100% or 90% identity.
1 to 17 of 17  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A286ZMX5A0A286ZMX5_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_A0A286ZMX5
UniRef90_A0A286ZMX5
97Representative
A0A2R8PND0A0A2R8PND0_CALJAUncharacterized proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A2R8PND0
UniRef90_A0A2R8PND0
97
A0A2K5PBF9A0A2K5PBF9_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5PBF9
UniRef90_A0A2R8PND0
92
A6YNG5A6YNG5_9BILASmall subunit ribosomal protein 25 (Fragment)Pristionchus sp. 6 RS5101358043UniRef100_A6YNG5
UniRef90_A6YNG5
109
A6YNG4A6YNG4_9BILASmall subunit ribosomal protein 25 (Fragment)Pristionchus aerivorus376548UniRef100_A6YNG4
UniRef90_A6YNG5
110
A6YNG8A6YNG8_9BILASmall subunit ribosomal protein 25 (Fragment)Pristionchus pseudaerivorus376547UniRef100_A6YNG4
UniRef90_A6YNG5
110
A6YNG1A6YNG1_9BILASmall subunit ribosomal protein 25 (Fragment)Pristionchus uniformis358041UniRef100_A6YNG1
UniRef90_A6YNG5
110
A6YNG3A6YNG3_9BILASmall subunit ribosomal protein 25 (Fragment)Pristionchus sp. 4 RS5050358042UniRef100_A6YNG3
UniRef90_A6YNG5
110
S5M715S5M715_9BILASubunit ribosomal protein 25 (Fragment)Pristionchus fukushimae1355912UniRef100_S5M715
UniRef90_A6YNG5
109
A6YNH0A6YNH0_9BILASmall subunit ribosomal protein 25 (Fragment)Pristionchus sp. 11 RS5228452806UniRef100_A6YNH0
UniRef90_A6YNG5
109
A0A0S2KP66A0A0S2KP66_9BILASmall subunit ribosomal protein 25 (Fragment)Micoletzkya masseyi1250333UniRef100_A0A0S2KP66
UniRef90_A6YNG5
109
A6YNG9A6YNG9_9BILASmall subunit ribosomal protein 25 (Fragment)Pristionchus sp. 10 RS5133452805UniRef100_A6YNG9
UniRef90_A6YNG5
109
S5MCB2S5MCB2_9BILASubunit ribosomal protein 25 (Fragment)Parapristionchus giblindavisi1187980UniRef100_S5MCB2
UniRef90_A6YNG5
109
A6YNH4A6YNH4_9BILASmall subunit ribosomal protein 25 (Fragment)Pristionchus sp. 15 RS5229452809UniRef100_A6YNH4
UniRef90_A6YNG5
109
M9V2J3M9V2J3_9BILASmall subunit ribosomal protein 25 (Fragment)Pristionchus bucculentus1317126UniRef100_M9V2J3
UniRef90_A6YNG5
109
A0A183WJD7A0A183WJD7_TRIREUncharacterized proteinTrichobilharzia regenti (Nasal bird schistosome)157069UniRef100_A0A183WJD7
UniRef90_A0A183WJD7
101
A0A1D1UJI4A0A1D1UJI4_RAMVAUncharacterized proteinRamazzottius varieornatus (Water bear) (Tardigrade)947166UniRef100_A0A1D1UJI4
UniRef90_A0A1D1UJI4
121Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A286ZMX5

Checksumi: E2E9118823906947

FASTA9710,856
        10         20         30         40         50
KPPKIKKKKK KDAGKSAKKD KDPVNKSGGK AQKKKWSKGK VWDKLNNLVS
60 70 80 90
FDKLIIPAII SERLKIRGSL ARAALQKLLS KGLIKLVSKH RAQVIYT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again