Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A0A2G2VTI4 Non-specific lipid-transfer protein n=3 Tax=Solanaceae TaxID=4070 RepID=A0A2G2VTI4_CAPBA MEMAGKIACFVLLCMTVVAPHAEALSCGEVQSSMAPCVPYLTGRGPLGGCCGGVKGLLGA AKTPADRKTACTCLKSAASTIKGIDGGKAASLPSVCGVNIPYKISPSTDCSMYKQFNLRL IFLEFKGTWLHMLASLLKFIFSEIMPPQRSDACRNSFVFPKDNVNGTRPVYRVQTWFGIL SLHRTTSRRVPPDPTSPPRAL

Members

List component clusters with 100% or 90% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2G2VTI4A0A2G2VTI4_CAPBANon-specific lipid-transfer proteinCapsicum baccatum (Peruvian pepper)33114UniRef100_A0A2G2VTI4
UniRef90_A0A2G2VTI4
201Representative & Seed
A0A1S3X2D4A0A1S3X2D4_TOBACNon-specific lipid-transfer proteinNicotiana tabacum (Common tobacco)4097UniRef100_A0A1S3X2D4
UniRef90_A0A1S3X2D4
162
Q8LK72Q8LK72_TOBACNon-specific lipid-transfer proteinNicotiana tabacum (Common tobacco)4097UniRef100_A0A1S3X2D4
UniRef90_A0A1S3X2D4
114

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2G2VTI4

Checksumi: F9EBC554270EFE2A

FASTA20121,588
        10         20         30         40         50
MEMAGKIACF VLLCMTVVAP HAEALSCGEV QSSMAPCVPY LTGRGPLGGC
60 70 80 90 100
CGGVKGLLGA AKTPADRKTA CTCLKSAAST IKGIDGGKAA SLPSVCGVNI
110 120 130 140 150
PYKISPSTDC SMYKQFNLRL IFLEFKGTWL HMLASLLKFI FSEIMPPQRS
160 170 180 190 200
DACRNSFVFP KDNVNGTRPV YRVQTWFGIL SLHRTTSRRV PPDPTSPPRA

L
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again