Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A0A2K5R0D7 CS domain-containing protein n=45 Tax=Euteleostomi TaxID=117571 RepID=A0A2K5R0D7_CEBCA MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID PNLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEDSQDSDDEKMPDLE

Members

List component clusters with 100% or 90% identity.
1 to 25 of 45  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2K5R0D7A0A2K5R0D7_CEBCACS domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5R0D7
UniRef90_A0A2K5R0D7
106Representative
A0A212DF04A0A212DF04_CEREHPTGES3 (Fragment)Cervus elaphus hippelaphus (European red deer)46360UniRef100_A0A212DF04
UniRef90_A0A2K5R0D7
130
A0A4X2M3P1A0A4X2M3P1_VOMURCS domain-containing proteinVombatus ursinus (Common wombat)29139UniRef100_A0A4X2M3P1
UniRef90_A0A2K5R0D7
127
A0A2I3RC27A0A2I3RC27_PANTRPTGES3 isoform 5Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A4W2CSZ8A0A4W2CSZ8_BOBOXCS domain-containing proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A1S3ADM9A0A1S3ADM9_ERIEUprostaglandin E synthase 3 isoform X3Erinaceus europaeus (Western European hedgehog)9365UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2K6PSW8A0A2K6PSW8_RHIROCS domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
F7CNT9F7CNT9_CALJACS domain-containing proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A1D5QBR2A0A1D5QBR2_MACMUCS domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2J8UHP4A0A2J8UHP4_PONABPTGES3 isoform 6Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A337S758A0A337S758_FELCACS domain-containing proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2I3NA89A0A2I3NA89_PAPANCS domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2K5EFI7A0A2K5EFI7_AOTNACS domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2R8ZDN0A0A2R8ZDN0_PANPACS domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A340Y3B3A0A340Y3B3_LIPVEprostaglandin E synthase 3 isoform X4Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A4X1W7W2A0A4X1W7W2_PIGCS domain-containing proteinSus scrofa (Pig)9823UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2K6AI88A0A2K6AI88_MANLECS domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2I3GBX1A0A2I3GBX1_NOMLECS domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2I2ZSV7A0A2I2ZSV7_GORGOProstaglandin E synthase 3Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2K5VUI8A0A2K5VUI8_MACFACS domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2K6C2H1A0A2K6C2H1_MACNECS domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2K6S5C7A0A2K6S5C7_SAIBBProstaglandin E synthase 3Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2K6GXL4A0A2K6GXL4_PROCOCS domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2K5HVN2A0A2K5HVN2_COLAPCS domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127
A0A2U3ZH30A0A2U3ZH30_ODOROprostaglandin E synthase 3 isoform X4Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2I3RC27
UniRef90_A0A2K5R0D7
127

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2K5R0D7

Checksumi: A1E122F83EDDDFB3

FASTA10612,623
        10         20         30         40         50
MQPASAKWYD RRDYVFIEFC VEDSKDVNVN FEKSKLTFSC LGGSDNFKHL
60 70 80 90 100
NEIDLFHCID PNLNWLSVDF NNWKDWEDDS DEDMSNFDRF SEDSQDSDDE

KMPDLE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again