Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A0A2K5X0E5 BTB domain-containing protein n=21 Tax=Euteleostomi TaxID=117571 RepID=A0A2K5X0E5_MACFA MLGGTDCRTFLTSHINLKKTLCDVILMVQERKIPAHRVVLAAASHFFNLMFTTNMLESKS FEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQVD ASNCLGEAEKVDQTLPECGMLLAM

Members

List component clusters with 100% or 90% identity.
1 to 21 of 21  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2K5X0E5A0A2K5X0E5_MACFABTB domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5X0E5
UniRef90_A0A2K5X0E5
144Representative
A0A2K5Z0L1A0A2K5Z0L1_MANLEBTB domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5Z0L1
UniRef90_A0A2K5X0E5
144
A0A2K5JKM4A0A2K5JKM4_COLAPBTB domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5JKM4
UniRef90_A0A2K5X0E5
144
A0A2J8VE61A0A2J8VE61_PONABKLHL7 isoform 11Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VE61
UniRef90_A0A2K5X0E5
144
A0A2J8KZI9A0A2J8KZI9_PANTRKLHL7 isoform 11Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8VE61
UniRef90_A0A2K5X0E5
144
A0A2I3HAG5A0A2I3HAG5_NOMLEBTB domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2J8VE61
UniRef90_A0A2K5X0E5
144
A0A2I2Y9Q6A0A2I2Y9Q6_GORGOKelch like family member 7Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2J8VE61
UniRef90_A0A2K5X0E5
144
Q8IXQ5-4Isoform 4 of KLHL7_HUMAN4Homo sapiens (Human)9606UniRef100_A0A2J8VE61
UniRef90_A0A2K5X0E5
144
A0A2K6CQJ8A0A2K6CQJ8_MACNEBTB domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6CQJ8
UniRef90_A0A2K5X0E5
144
A0A2K6FNE1A0A2K6FNE1_PROCOBTB domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6FNE1
UniRef90_A0A2K5X0E5
144
A0A2K5CQK8A0A2K5CQK8_AOTNABTB domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5CQK8
UniRef90_A0A2K5X0E5
143
A0A2K6LAQ8A0A2K6LAQ8_RHIBEBTB domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6LAQ8
UniRef90_A0A2K5X0E5
143
F7IDY2F7IDY2_CALJABTB domain-containing proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7IDY2
UniRef90_A0A2K5X0E5
143
A0A2K6U7I7A0A2K6U7I7_SAIBBKelch like family member 7Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_F7IDY2
UniRef90_A0A2K5X0E5
143
A0A2K6PCG5A0A2K6PCG5_RHIROBTB domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PCG5
UniRef90_A0A2K5X0E5
143
A0A2K5RF15A0A2K5RF15_CEBCABTB domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5RF15
UniRef90_A0A2K5X0E5
139
A0A3B4ZJG7A0A3B4ZJG7_9TELEBTB domain-containing proteinStegastes partitus (bicolor damselfish)144197UniRef100_A0A3B4ZJG7
UniRef90_A0A3B4ZJG7
159
A0A3P9KS54A0A3P9KS54_ORYLABTB domain-containing proteinOryzias latipes (Japanese rice fish) (Japanese killifish)8090UniRef100_A0A3P9KS54
UniRef90_A0A3P9KS54
177Seed
A0A3B4BI84A0A3B4BI84_9GOBIBTB domain-containing proteinPeriophthalmus magnuspinnatus409849UniRef100_A0A3B4BI84
UniRef90_A0A3B4BI84
167
A0A437CWE9A0A437CWE9_ORYJABTB domain-containing proteinOryzias javanicus (Javanese ricefish) (Aplocheilus javanicus)123683UniRef100_A0A437CWE9
UniRef90_A0A437CWE9
160
A0A4W2GE33A0A4W2GE33_BOBOXBTB domain-containing proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2GE33
UniRef90_A0A4W2GE33
148

Sequence

Representative sequenceiLengthMass (Da)Tools
A0A2K5X0E5

Checksumi: 848102F6869455D7

FASTA14416,159
        10         20         30         40         50
MLGGTDCRTF LTSHINLKKT LCDVILMVQE RKIPAHRVVL AAASHFFNLM
60 70 80 90 100
FTTNMLESKS FEVELKDAEP DIIEQLVEFA YTARISVNSN NVQSLLDAAN
110 120 130 140
QYQIEPVKKM CVDFLKEQVD ASNCLGEAEK VDQTLPECGM LLAM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again