Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A2QAN3 Beta-galactosidase A n=337 Tax=cellular organisms TaxID=131567 RepID=BGALA_ASPNC MKLSSACAIALLAAQAAGASIKHRINGFTLTEHSDPAKRELLQKYVTWDDKSLFINGERI MIFSGEFHPFRLPVKELQLDIFQKVKALGFNCVSFYVDWALVEGKPGEYRADGIFDLEPF FDAASEAGIYLLARPGPYINAESSGGGFPGWLQRVNGTLRSSDKAYLDATDNYVSHVAAT IAKYQITNGGPIILYQPENEYTSGCCGVEFPDPVYMQYVEDQARNAGVVIPLINNDASAS GNNAPGTGKGAVDIYGHDSYPLGFDCANPTVWPSGDLPTNFRTLHLEQSPTTPYAIVEFQ GGSYDPWGGPGFAACSELLNNEFERVFYKNDFSFQIAIMNLYMIFGGTNWGNLGYPNGYT SYDYGSAVTESRNITREKYSELKLLGNFAKVSPGYLTASPGNLTTSGYADTTDLTVTPLL GNSTGSFFVVRHSDYSSEESTSYKLRLPTSAGSVTIPQLGGTLTLNGRDSKIHVTDYNVS GTNIIYSTAEVFTWKKFADGKVLVLYGGAGEHHELAISTKSNVTVIEGSESGISSKQTSS SVVVGWDVSTTRRIIQVGDLKILLLDRNSAYNYWVPQLATDGTSPGFSTPEKVASSIIVK AGYLVRTAYLKGSGLYLTADFNATTSVEVIGVPSTAKNLFINGDKTSHTVDKNGIWSATV DYNAPDISLPSLKDLDWKYVDTLPEIQSSYDDSLWPAADLKQTKNTLRSLTTPTSLYSSD YGFHTGYLLYRGHFTATGNESTFAIDTQGGSAFGSSVWLNGTYLGSWTGLYANSDYNATY NLPQLQAGKTYVITVVIDNMGLEENWTVGEDLMKTPRGILNFLLAGRPSSAISWKLTGNL GGEDYEDKVRGPLNEGGLYAERQGFHQPEPPSQNWKSSSPLEGLSEAGIGFYSASFDLDL PKGWDVPLFLNIGNSTTPSPYRVQVYVNGYQYAKYISNIGPQTSFPVPEGILNYRGTNWL AVTLWALDSAGGKLESLELSYTTPVLTALGEVESVDQPKYKKRKGAY

Members

List component clusters with 100% or 90% identity.
1 to 25 of 337  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A2QAN3BGALA_ASPNCBeta-galactosidase AAspergillus niger (strain CBS 513.88 / FGSC A1513)425011UniRef100_A2QAN3
UniRef90_A2QAN3
1,007Representative
Q4ZHV7BGALA_ASPPHProbable beta-galactosidase AAspergillus phoenicis (Aspergillus saitoi)5063UniRef100_Q4ZHV7
UniRef90_A2QAN3
1,007
P29853BGAL_ASPNGBeta-galactosidaseAspergillus niger5061UniRef100_P29853
UniRef90_A2QAN3
1,006
Q2UCU3BGALA_ASPORBeta-galactosidase AAspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)510516UniRef100_Q2UCU3
UniRef90_Q2UCU3
1,005
B8N6V7BGALA_ASPFNProbable beta-galactosidase AAspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167)332952UniRef100_Q2UCU3
UniRef90_Q2UCU3
1,005
B0XMP7BGALA_ASPFCProbable beta-galactosidase ANeosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)451804UniRef100_B0XMP7
UniRef90_Q4WS33
1,006
A1D1Z9BGALA_NEOFIProbable beta-galactosidase ANeosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)331117UniRef100_A1D1Z9
UniRef90_Q4WS33
1,006
Q4WS33BGALA_ASPFUProbable beta-galactosidase ANeosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)330879UniRef100_Q4WS33
UniRef90_Q4WS33
1,006
A1DJ58BGALE_NEOFIProbable beta-galactosidase ENeosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus)331117UniRef100_A1DJ58
UniRef90_A1DJ58
1,011
B0XXE7BGALE_ASPFCProbable beta-galactosidase ENeosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)451804UniRef100_B0XXE7
UniRef90_A1DJ58
1,011
Q4WG05BGALE_ASPFUProbable beta-galactosidase ENeosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)330879UniRef100_B0XXE7
UniRef90_A1DJ58
1,011
Q5BFC4BGALA_EMENIProbable beta-galactosidase AEmericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)227321UniRef100_Q5BFC4
UniRef90_Q5BFC4
1,007
Q700S9BGALA_PENSQBeta-galactosidase APenicillium sp.5081UniRef100_Q700S9
UniRef90_Q700S9
1,011
B8QGZ3BGALA_PENENProbable beta-galactosidase APenicillium expansum (Blue mold rot fungus)27334UniRef100_B8QGZ3
UniRef90_B8QGZ3
1,011
A0A254TWC0A0A254TWC0_ASPNGBeta-galactosidaseAspergillus niger5061UniRef100_A2QAN3
UniRef90_A2QAN3
1,007
G3XR77G3XR77_ASPNABeta-galactosidaseAspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)380704UniRef100_A2QAN3
UniRef90_A2QAN3
1,007
A0A319ADP6A0A319ADP6_ASPLBBeta-galactosidaseAspergillus lacticoffeatus (strain CBS 101883)1450533UniRef100_A2QAN3
UniRef90_A2QAN3
1,007
A0A370BMT6A0A370BMT6_ASPNGBeta-galactosidaseAspergillus niger ATCC 134961353008UniRef100_A2QAN3
UniRef90_A2QAN3
1,007
A0A1L9N741A0A1L9N741_ASPTCBeta-galactosidaseAspergillus tubingensis (strain CBS 134.48)767770UniRef100_A0A1L9N741
UniRef90_A2QAN3
1,015
A0A1L9US22A0A1L9US22_ASPBCBeta-galactosidaseAspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)767769UniRef100_A0A1L9US22
UniRef90_A2QAN3
1,008
B6HYI9B6HYI9_ASPNGBeta-galactosidaseAspergillus niger5061UniRef100_B6HYI9
UniRef90_A2QAN3
1,007
G7XIA3G7XIA3_ASPKWBeta-galactosidaseAspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)1033177UniRef100_G7XIA3
UniRef90_A2QAN3
1,007
A0A401L3U6A0A401L3U6_ASPAWBeta-galactosidaseAspergillus awamori (Black koji mold)105351UniRef100_A0A401L3U6
UniRef90_A2QAN3
1,007
A0A100I7G1A0A100I7G1_ASPNGBeta-galactosidaseAspergillus niger5061UniRef100_A0A100I7G1
UniRef90_A2QAN3
1,007
A0A319B661A0A319B661_ASPVCBeta-galactosidaseAspergillus vadensis (strain CBS 113365 / IMI 142717 / IBT 24658)1448311UniRef100_A0A319B661
UniRef90_A2QAN3
1,007

Sequence

Representative sequenceiLengthMass (Da)Tools
A2QAN3

Checksumi: CD1E91854D7A8A0A

FASTA1,007109,711
        10         20         30         40         50
MKLSSACAIA LLAAQAAGAS IKHRINGFTL TEHSDPAKRE LLQKYVTWDD
60 70 80 90 100
KSLFINGERI MIFSGEFHPF RLPVKELQLD IFQKVKALGF NCVSFYVDWA
110 120 130 140 150
LVEGKPGEYR ADGIFDLEPF FDAASEAGIY LLARPGPYIN AESSGGGFPG
160 170 180 190 200
WLQRVNGTLR SSDKAYLDAT DNYVSHVAAT IAKYQITNGG PIILYQPENE
210 220 230 240 250
YTSGCCGVEF PDPVYMQYVE DQARNAGVVI PLINNDASAS GNNAPGTGKG
260 270 280 290 300
AVDIYGHDSY PLGFDCANPT VWPSGDLPTN FRTLHLEQSP TTPYAIVEFQ
310 320 330 340 350
GGSYDPWGGP GFAACSELLN NEFERVFYKN DFSFQIAIMN LYMIFGGTNW
360 370 380 390 400
GNLGYPNGYT SYDYGSAVTE SRNITREKYS ELKLLGNFAK VSPGYLTASP
410 420 430 440 450
GNLTTSGYAD TTDLTVTPLL GNSTGSFFVV RHSDYSSEES TSYKLRLPTS
460 470 480 490 500
AGSVTIPQLG GTLTLNGRDS KIHVTDYNVS GTNIIYSTAE VFTWKKFADG
510 520 530 540 550
KVLVLYGGAG EHHELAISTK SNVTVIEGSE SGISSKQTSS SVVVGWDVST
560 570 580 590 600
TRRIIQVGDL KILLLDRNSA YNYWVPQLAT DGTSPGFSTP EKVASSIIVK
610 620 630 640 650
AGYLVRTAYL KGSGLYLTAD FNATTSVEVI GVPSTAKNLF INGDKTSHTV
660 670 680 690 700
DKNGIWSATV DYNAPDISLP SLKDLDWKYV DTLPEIQSSY DDSLWPAADL
710 720 730 740 750
KQTKNTLRSL TTPTSLYSSD YGFHTGYLLY RGHFTATGNE STFAIDTQGG
760 770 780 790 800
SAFGSSVWLN GTYLGSWTGL YANSDYNATY NLPQLQAGKT YVITVVIDNM
810 820 830 840 850
GLEENWTVGE DLMKTPRGIL NFLLAGRPSS AISWKLTGNL GGEDYEDKVR
860 870 880 890 900
GPLNEGGLYA ERQGFHQPEP PSQNWKSSSP LEGLSEAGIG FYSASFDLDL
910 920 930 940 950
PKGWDVPLFL NIGNSTTPSP YRVQVYVNGY QYAKYISNIG PQTSFPVPEG
960 970 980 990 1000
ILNYRGTNWL AVTLWALDSA GGKLESLELS YTTPVLTALG EVESVDQPKY

KKRKGAY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again