Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A7ZUJ8 50S ribosomal protein L10 n=1959 RepID=RL10_ECO24 MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLL RRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPA SQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 1,959  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A7ZUJ8RL10_ECO2450S ribosomal protein L10Escherichia coli O139:H28 (strain E24377A / ETEC)331111UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165Representative
B7UPE0RL10_ECO2750S ribosomal protein L10Escherichia coli O127:H6 (strain E2348/69 / EPEC)574521UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B7MIX1RL10_ECO4550S ribosomal protein L10Escherichia coli O45:K1 (strain S88 / ExPEC)585035UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B7LA78RL10_ECO5550S ribosomal protein L10Escherichia coli (strain 55989 / EAEC)585055UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
P0A7J5RL10_ECO5750S ribosomal protein L10Escherichia coli O157:H783334UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B5Z081RL10_ECO5E50S ribosomal protein L10Escherichia coli O157:H7 (strain EC4115 / EHEC)444450UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B7NRR3RL10_ECO7I50S ribosomal protein L10Escherichia coli O7:K1 (strain IAI39 / ExPEC)585057UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B7MR71RL10_ECO8150S ribosomal protein L10Escherichia coli O81 (strain ED1a)585397UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B7M732RL10_ECO8A50S ribosomal protein L10Escherichia coli O8 (strain IAI1)585034UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
C5A0S5RL10_ECOBW50S ribosomal protein L10Escherichia coli (strain K12 / MC4100 / BW2952)595496UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B1XBY7RL10_ECODH50S ribosomal protein L10Escherichia coli (strain K12 / DH10B)316385UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
A8A784RL10_ECOHS50S ribosomal protein L10Escherichia coli O9:H4 (strain HS)331112UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
A1AIF7RL10_ECOK150S ribosomal protein L10Escherichia coli O1:K1 / APEC405955UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
Q0TA80RL10_ECOL550S ribosomal protein L10Escherichia coli O6:K15:H31 (strain 536 / UPEC)362663UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
P0A7J4RL10_ECOL650S ribosomal protein L10Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)199310UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B1IUR2RL10_ECOLC50S ribosomal protein L10Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)481805UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
P0A7J3RL10_ECOLI50S ribosomal protein L10Escherichia coli (strain K12)83333UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B7NFS5RL10_ECOLU50S ribosomal protein L10Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)585056UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B6I5J5RL10_ECOSE50S ribosomal protein L10Escherichia coli (strain SE11)409438UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B1LNT7RL10_ECOSM50S ribosomal protein L10Escherichia coli (strain SMS-3-5 / SECEC)439855UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
Q1R5V0RL10_ECOUT50S ribosomal protein L10Escherichia coli (strain UTI89 / UPEC)364106UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B7LUL7RL10_ESCF350S ribosomal protein L10Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)585054UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
B2TWH1RL10_SHIB350S ribosomal protein L10Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)344609UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
Q31U12RL10_SHIBS50S ribosomal protein L10Shigella boydii serotype 4 (strain Sb227)300268UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165
Q32AF7RL10_SHIDS50S ribosomal protein L10Shigella dysenteriae serotype 1 (strain Sd197)300267UniRef100_A7ZUJ8
UniRef90_A7ZUJ8
165

Sequence

Representative sequenceiLengthMass (Da)Tools
A7ZUJ8

Checksumi: F15822B0EDB6AC02

FASTA16517,712
        10         20         30         40         50
MALNLQDKQA IVAEVSEVAK GALSAVVADS RGVTVDKMTE LRKAGREAGV
60 70 80 90 100
YMRVVRNTLL RRAVEGTPFE CLKDAFVGPT LIAYSMEHPG AAARLFKEFA
110 120 130 140 150
KANAKFEVKA AAFEGELIPA SQIDRLATLP TYEEAIARLM ATMKEASAGK
160
LVRTLAAVRD AKEAA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again