Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A8M0Z1 50S ribosomal protein L21 n=560 Tax=Bacteria TaxID=2 RepID=RL21_SALAI MYAIVKTGGKQYKVAEGDVIEVEKLAGAPGDAVQLAAVLLVDGDDLVTDAAKLAEVEVSG EIAAHTKGPKIRIHKFKNKTGYHKRQGHRQPLTQVKVTGISSGK

Members

List component clusters with 100% or 90% identity.
1 to 25 of 560  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A8M0Z1RL21_SALAI50S ribosomal protein L21Salinispora arenicola (strain CNS-205)391037UniRef100_A8M0Z1
UniRef90_A8M0Z1
104Representative
A4XAG3RL21_SALTO50S ribosomal protein L21Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440)369723UniRef100_A4XAG3
UniRef90_A8M0Z1
104
Q5Z043RL21_NOCFA50S ribosomal protein L21Nocardia farcinica (strain IFM 10152)247156UniRef100_Q5Z043
UniRef90_Q5Z043
103
B1MMY3RL21_MYCA950S ribosomal protein L21Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) (Mycobacterium abscessus)561007UniRef100_B1MMY3
UniRef90_B1MMY3
103
C1A1L7RL21_RHOE450S ribosomal protein L21Rhodococcus erythropolis (strain PR4 / NBRC 100887)234621UniRef100_C1A1L7
UniRef90_C1A1L7
103
A4QG85RL21_CORGB50S ribosomal protein L21Corynebacterium glutamicum (strain R)340322UniRef100_A4QG85
UniRef90_A4QG85
101
Q8NN50RL21_CORGL50S ribosomal protein L21Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)196627UniRef100_A4QG85
UniRef90_A4QG85
101
Q0SH49RL21_RHOJR50S ribosomal protein L21Rhodococcus jostii (strain RHA1)101510UniRef100_Q0SH49
UniRef90_Q0SH49
103
C1AVK2RL21_RHOOB50S ribosomal protein L21Rhodococcus opacus (strain B4)632772UniRef100_Q0SH49
UniRef90_Q0SH49
103
A0A542XNP4A0A542XNP4_9ACTNLSU ribosomal protein L21PSalinispora arenicola168697UniRef100_A8M0Z1
UniRef90_A8M0Z1
104
A0A1C5K9G7A0A1C5K9G7_9ACTN50S ribosomal protein L21Micromonospora humi745366UniRef100_A0A1C5K9G7
UniRef90_A8M0Z1
105
A0A1A8ZQD1A0A1A8ZQD1_9ACTN50S ribosomal protein L21Micromonospora auratinigra261654UniRef100_A0A1C5K9G7
UniRef90_A8M0Z1
105
A0A2T3VMA0A0A2T3VMA0_9ACTN50S ribosomal protein L21Micromonospora sp. RP3T2135446UniRef100_A0A1C5K9G7
UniRef90_A8M0Z1
105
A0A1A9B7M3A0A1A9B7M3_9ACTN50S ribosomal protein L21Micromonospora sediminicola946078UniRef100_A0A1C5K9G7
UniRef90_A8M0Z1
105
A0A2D1IGW1A0A2D1IGW1_9ACTN50S ribosomal protein L21Micromonospora sp. WMMA20322039870UniRef100_A0A2D1IGW1
UniRef90_A8M0Z1
105
F4F591F4F591_VERMA50S ribosomal protein L21Verrucosispora maris (strain AB-18-032)263358UniRef100_F4F591
UniRef90_A8M0Z1
104
A0A2W2C3W8A0A2W2C3W8_9ACTN50S ribosomal protein L21Jishengella endophytica515350UniRef100_F4F591
UniRef90_A8M0Z1
104
A0A432MTS2A0A432MTS2_9ACTN50S ribosomal protein L21Verrucosispora sp. FIM0600221479020UniRef100_F4F591
UniRef90_A8M0Z1
104
A0A2N7SZ77A0A2N7SZ77_9ACTN50S ribosomal protein L21Verrucosispora sp. ts212069341UniRef100_F4F591
UniRef90_A8M0Z1
104
A0A418MQH0A0A418MQH0_9ACTN50S ribosomal protein L21Jishengella sp. AZ1-131894971UniRef100_F4F591
UniRef90_A8M0Z1
104
A0A2W2F664A0A2W2F664_9ACTN50S ribosomal protein L21Jishengella sp. NA121655439UniRef100_F4F591
UniRef90_A8M0Z1
104
A0A3N1AYV0A0A3N1AYV0_9ACTN50S ribosomal protein L21Micromonospora sp. Llam02485143UniRef100_A0A3N1AYV0
UniRef90_A8M0Z1
104
A0A4R0GGT4A0A4R0GGT4_9ACTN50S ribosomal protein L21Jishengella zingiberis2053011UniRef100_A0A4R0GGT4
UniRef90_A8M0Z1
104
A0A239MFK7A0A239MFK7_9ACTN50S ribosomal protein L21Asanoa hainanensis560556UniRef100_A0A239MFK7
UniRef90_A8M0Z1
104
A0A109IHS1A0A109IHS1_9ACTN50S ribosomal protein L21Micromonospora rifamycinica291594UniRef100_A0A109IHS1
UniRef90_A8M0Z1
104

Sequence

Representative sequenceiLengthMass (Da)Tools
A8M0Z1

Checksumi: 2E3073727C195F31

FASTA10411,047
        10         20         30         40         50
MYAIVKTGGK QYKVAEGDVI EVEKLAGAPG DAVQLAAVLL VDGDDLVTDA
60 70 80 90 100
AKLAEVEVSG EIAAHTKGPK IRIHKFKNKT GYHKRQGHRQ PLTQVKVTGI

SSGK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again