Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A8MPH9-2 Isoform sro of Transcription factor kayak, isoforms D/sro n=5 Tax=melanogaster group TaxID=32346 RepID=Isoform 2 of FOSLD_DROME MIALKATEMQHNNNALQQQQQLQHQLLQQHQQQHQQQLQQQLNSPDNNYIWATTHNANIS RNNAMLQLQQQQLRAPWITDCNKQHHINNNNSMNVNYNQQLTQQPQQQQQQTQYMQHNYN NYTQQQQQQHLVPATTSQSNSHFYQCNQQQQQQQFLAPTTTTAAVVVAAAHQQHQTQQQH QSQQQQQHQRQDYASLQMGRQVSGLVKCVR

Members

List component clusters with 100% or 90% identity.
1 to 5 of 5  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A8MPH9-2Isoform 2 of FOSLD_DROMEsro, shroudDrosophila melanogaster (Fruit fly)7227UniRef100_A8MPH9-2
UniRef90_A8MPH9-2
210Representative
B3P5D5B3P5D5_DROERGG11692Drosophila erecta (Fruit fly)7220UniRef100_B3P5D5
UniRef90_B3P5D5
219Seed
B4HZE4B4HZE4_DROSEGM12818Drosophila sechellia (Fruit fly)7238UniRef100_B4HZE4
UniRef90_B4R086
212
B4R086B4R086_DROSIGD21462Drosophila simulans (Fruit fly)7240UniRef100_B4R086
UniRef90_B4R086
212
UPI0007E763DAtranscription factor kayak, isoforms D/sro-likeDrosophila takahashii (Fruit fly)29030UniRef100_UPI0007E763DA
UniRef90_UPI0007E763DA
213

Sequence

Representative sequenceiLengthMass (Da)Tools
A8MPH9-2

Checksumi: 4D7AFD54186AEB49

FASTA21024,742
        10         20         30         40         50
MIALKATEMQ HNNNALQQQQ QLQHQLLQQH QQQHQQQLQQ QLNSPDNNYI
60 70 80 90 100
WATTHNANIS RNNAMLQLQQ QQLRAPWITD CNKQHHINNN NSMNVNYNQQ
110 120 130 140 150
LTQQPQQQQQ QTQYMQHNYN NYTQQQQQQH LVPATTSQSN SHFYQCNQQQ
160 170 180 190 200
QQQQFLAPTT TTAAVVVAAA HQQHQTQQQH QSQQQQQHQR QDYASLQMGR
210
QVSGLVKCVR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again