Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_A9UMS3 Prohibitin-2 n=281 Tax=Opisthokonta TaxID=33154 RepID=PHB2_XENTR MAQNLKDFAGRLPAGPRGMGTAMKLLLGAGAVAYAVKESVFTVEGGHRAIFFNRIGGVQQ DTILAEGLHFRFPWFQYPIIYDIRARPRKISSPTGSKDLQMVNITLRVLSRPLASELPFM YQRLGLDYDERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSIILD DVAITELSFSREYTAAVESKQVAQQEAQRAQFLVEKAKQDQKQKIVQAEGEAAAAKMIGD ALSKNPGYLKLRRIRAAQSIAKTIASSQNRVYLNADSLVLNLQDDTFTRGSDSLVAKQTK K

Members

List component clusters with 100% or 90% identity.
1 to 25 of 281  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A9UMS3PHB2_XENTRProhibitin-2Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)8364UniRef100_A9UMS3
UniRef90_A9UMS3
301Representative
A0A1L8FIF9A0A1L8FIF9_XENLAProhibitinXenopus laevis (African clawed frog)8355UniRef100_A0A1L8FIF9
UniRef90_A9UMS3
347
Q6DEB3Q6DEB3_XENLAProhibitinXenopus laevis (African clawed frog)8355UniRef100_Q6DEB3
UniRef90_A9UMS3
301
Q6DKA8Q6DKA8_XENLAProhibitinXenopus laevis (African clawed frog)8355UniRef100_Q6DKA8
UniRef90_A9UMS3
301
F7E8X3F7E8X3_XENTRProhibitinXenopus tropicalis (Western clawed frog) (Silurana tropicalis)8364UniRef100_F7E8X3
UniRef90_A9UMS3
293
F6Y9B9F6Y9B9_XENTRProhibitinXenopus tropicalis (Western clawed frog) (Silurana tropicalis)8364UniRef100_F6Y9B9
UniRef90_A9UMS3
290
Q6PC13Q6PC13_DANREProhibitinDanio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_Q6PC13
UniRef90_Q6PC13
302
C4WSH5C4WSH5_ACYPIProhibitinAcyrthosiphon pisum (Pea aphid)7029UniRef100_C4WSH5
UniRef90_C4WSH5
328
A0A2S2QG11A0A2S2QG11_9HEMIProhibitin (Fragment)Sipha flava (yellow sugarcane aphid)143950UniRef100_A0A2S2QG11
UniRef90_C4WSH5
146
A0A0T6B5F9A0A0T6B5F9_9SCARProhibitinOryctes borbonicus1629725UniRef100_A0A0T6B5F9
UniRef90_A0A482VKA7
299
A0A482VKA7A0A482VKA7_9CUCUProhibitin (Fragment)Asbolus verrucosus1661398UniRef100_A0A482VKA7
UniRef90_A0A482VKA7
287
N6TRG1N6TRG1_DENPDProhibitin (Fragment)Dendroctonus ponderosae (Mountain pine beetle)77166UniRef100_N6TRG1
UniRef90_N6TRG1
304
D2A682D2A682_TRICAProhibitinTribolium castaneum (Red flour beetle)7070UniRef100_D2A682
UniRef90_D2A682
324
A0A4W6CMK2A0A4W6CMK2_LATCAProhibitinLates calcarifer (Barramundi) (Holocentrus calcarifer)8187UniRef100_A0A4W6CMK2
UniRef90_A0A3B3VVC6
322
A0A087YM48A0A087YM48_POEFOProhibitinPoecilia formosa (Amazon molly) (Limia formosa)48698UniRef100_A0A087YM48
UniRef90_A0A3B3VVC6
303
A0A3B3XDP5A0A3B3XDP5_9TELEProhibitinPoecilia mexicana48701UniRef100_A0A3B3XDP5
UniRef90_A0A3B3VVC6
303
A0A3B3YQX1A0A3B3YQX1_9TELEProhibitinPoecilia mexicana48701UniRef100_A0A3B3XDP5
UniRef90_A0A3B3VVC6
284
A0A484CUK1A0A484CUK1_PERFVProhibitinPerca flavescens (American yellow perch) (Morone flavescens)8167UniRef100_A0A484CUK1
UniRef90_A0A3B3VVC6
297
A0A3Q1HQ57A0A3Q1HQ57_ANATEProhibitinAnabas testudineus (Climbing perch) (Anthias testudineus)64144UniRef100_A0A3Q1HQ57
UniRef90_A0A3B3VVC6
288
A0A3Q0T547A0A3Q0T547_AMPCIProhibitinAmphilophus citrinellus (Midas cichlid) (Cichlasoma citrinellum)61819UniRef100_A0A3Q0T547
UniRef90_A0A3B3VVC6
287
A0A3B3CY51A0A3B3CY51_ORYMEProhibitinOryzias melastigma (Marine medaka)30732UniRef100_A0A3B3CY51
UniRef90_A0A3B3VVC6
287
A0A3B3VVC6A0A3B3VVC6_9TELEProhibitinPoecilia latipinna (sailfin molly)48699UniRef100_A0A3B3VVC6
UniRef90_A0A3B3VVC6
284
A0A4W6CMM2A0A4W6CMM2_LATCAProhibitinLates calcarifer (Barramundi) (Holocentrus calcarifer)8187UniRef100_A0A4W6CMM2
UniRef90_A0A3B3VVC6
283
A0A3Q3CRI9A0A3Q3CRI9_HAPBUProhibitinHaplochromis burtoni (Burton's mouthbrooder) (Chromis burtoni)8153UniRef100_A0A3Q3CRI9
UniRef90_A0A3B3VVC6
277
A0A183GTU4A0A183GTU4_HELPZProhibitinHeligmosomoides polygyrus (Parasitic roundworm)6339UniRef100_A0A183GTU4
UniRef90_A0A183GTU4
316

Sequence

Representative sequenceiLengthMass (Da)Tools
A9UMS3

Checksumi: 46E4C3AD5BF90C90

FASTA30133,461
        10         20         30         40         50
MAQNLKDFAG RLPAGPRGMG TAMKLLLGAG AVAYAVKESV FTVEGGHRAI
60 70 80 90 100
FFNRIGGVQQ DTILAEGLHF RFPWFQYPII YDIRARPRKI SSPTGSKDLQ
110 120 130 140 150
MVNITLRVLS RPLASELPFM YQRLGLDYDE RVLPSIVNEV LKSVVAKFNA
160 170 180 190 200
SQLITQRAQV SLLIRRELTE RAKDFSIILD DVAITELSFS REYTAAVESK
210 220 230 240 250
QVAQQEAQRA QFLVEKAKQD QKQKIVQAEG EAAAAKMIGD ALSKNPGYLK
260 270 280 290 300
LRRIRAAQSI AKTIASSQNR VYLNADSLVL NLQDDTFTRG SDSLVAKQTK

K
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again