Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_B4KZ59 Letm1 RBD domain-containing protein n=56 Tax=Drosophilinae TaxID=43845 RepID=B4KZ59_DROMO MALALRVLCLAHSSGSLGRWPQERRRLLRLCCRSRLQSRQTTNYSTQEQESTSTATKAPP QIKRNVASEITSVGKVIYEATWDAKNSKNLSSQVKSGTTGEIVVRTATTPSSGPPKESKD KDKDDDKDKEQEQPKSKREQMRDNVQEYIFTRYFNYVKNYDKVLEKNFPKAMQLYRVFFE GVKDFFADMKRFLKISRIANHAPQGIRALNRQELELYMQMPRDMMKVAPALIGCSLPMVG YAFFPLVFWYPRIFLTPHFWTEPQRIEFQKYYTKRRLQCNKSVLRCLQAKLKQVEGHHKY AEFEAILGQLGSGTHPTPEALISVKDIFAEGPYSLLGMSRKHVKCLVKMHGLPNSLFKRH RLHEHAFLVHFMDMAITREGGVHNLSLASLRYSCCLRGLNPDDLSAEEMIDWLRKWVKVS TSIQGEHITLFLHLPVLLGYNHPNNWKTIYCNKTP

Members

List component clusters with 100% or 90% identity.
1 to 25 of 56  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B4KZ59B4KZ59_DROMOLetm1 RBD domain-containing proteinDrosophila mojavensis (Fruit fly)7230UniRef100_B4KZ59
UniRef90_B4KZ59
455Representative
A0A484BWG3A0A484BWG3_DRONALetm1 RBD domain-containing proteinDrosophila navojoa (Fruit fly)7232UniRef100_A0A484BWG3
UniRef90_B4KZ59
455
A0A0M4EI39A0A0M4EI39_DROBSCG5989Drosophila busckii (Fruit fly)30019UniRef100_A0A0M4EI39
UniRef90_A0A0M4EI39
446
B3M686B3M686_DROANLetm1 RBD domain-containing proteinDrosophila ananassae (Fruit fly)7217UniRef100_B3M686
UniRef90_B3M686
434
Q29D02Q29D02_DROPSLetm1 RBD domain-containing proteinDrosophila pseudoobscura pseudoobscura (Fruit fly)46245UniRef100_Q29D02
UniRef90_Q29D02
446
B4H9I2B4H9I2_DROPEGL10296Drosophila persimilis (Fruit fly)7234UniRef100_B4H9I2
UniRef90_Q29D02
446
A0A3B0JPK1A0A3B0JPK1_DROGUBlast:LETM1 domain-containing protein 1Drosophila guanche (Fruit fly)7266UniRef100_A0A3B0JPK1
UniRef90_Q29D02
444
B4IWL9B4IWL9_DROGRGH16148Drosophila grimshawi (Hawaiian fruit fly) (Idiomyia grimshawi)7222UniRef100_B4IWL9
UniRef90_B4IWL9
460Seed
B4N3P0B4N3P0_DROWIUncharacterized protein, isoform ADrosophila willistoni (Fruit fly)7260UniRef100_B4N3P0
UniRef90_B4N3P0
452
A7Y4E5A7Y4E5_DROMNAnon-66Db (Fragment)Drosophila montana (Fruit fly)40370UniRef100_A7Y4E5
UniRef90_B4LEK9
363
B4LEK9B4LEK9_DROVILetm1 RBD domain-containing proteinDrosophila virilis (Fruit fly)7244UniRef100_B4LEK9
UniRef90_B4LEK9
448
Q95ZE7Q95ZE7_DROVILetm1 RBD domain-containing proteinDrosophila virilis (Fruit fly)7244UniRef100_Q95ZE7
UniRef90_B4LEK9
441
Q5G5F5Q5G5F5_DROAEAnon-66Db (Fragment)Drosophila americana (Fruit fly)40366UniRef100_Q5G5F5
UniRef90_B4LEK9
365
Q5G5F4Q5G5F4_DROAEAnon-66Db (Fragment)Drosophila americana (Fruit fly)40366UniRef100_Q5G5F4
UniRef90_B4LEK9
365
Q5G5F8Q5G5F8_DROVIAnon-66Db (Fragment)Drosophila virilis (Fruit fly)7244UniRef100_Q5G5F8
UniRef90_B4LEK9
365
Q5G5F3Q5G5F3_DROAEAnon-66Db (Fragment)Drosophila americana (Fruit fly)40366UniRef100_Q5G5F3
UniRef90_B4LEK9
365
Q5G5F7Q5G5F7_DROAEAnon-66Db (Fragment)Drosophila americana (Fruit fly)40366UniRef100_Q5G5F7
UniRef90_B4LEK9
365
Q5G5F6Q5G5F6_DROAEAnon-66Db (Fragment)Drosophila americana (Fruit fly)40366UniRef100_Q5G5F6
UniRef90_B4LEK9
365
A7Y4E2A7Y4E2_DROLRAnon-66Db (Fragment)Drosophila littoralis (Fruit fly)47316UniRef100_A7Y4E2
UniRef90_B4LEK9
364
Q5G5F2Q5G5F2_DROEZAnon-66Db (Fragment)Drosophila ezoana (Fruit fly)47313UniRef100_Q5G5F2
UniRef90_B4LEK9
364
B4PG00B4PG00_DROYAUncharacterized protein, isoform ADrosophila yakuba (Fruit fly)7245UniRef100_B4PG00
UniRef90_B3NBR1
434
B4QM51B4QM51_DROSIGD12974Drosophila simulans (Fruit fly)7240UniRef100_B4QM51
UniRef90_B3NBR1
436
P91616P91616_DROMEANON-66DbDrosophila melanogaster (Fruit fly)7227UniRef100_P91616
UniRef90_B3NBR1
436
Q9VSM4Q9VSM4_DROMEGH26459pDrosophila melanogaster (Fruit fly)7227UniRef100_Q9VSM4
UniRef90_B3NBR1
436
P91617P91617_DROMEANON-66Db proteinDrosophila melanogaster (Fruit fly)7227UniRef100_P91617
UniRef90_B3NBR1
436

Sequence

Representative sequenceiLengthMass (Da)Tools
B4KZ59

Checksumi: 8DA71033A1E754BB

FASTA45552,638
        10         20         30         40         50
MALALRVLCL AHSSGSLGRW PQERRRLLRL CCRSRLQSRQ TTNYSTQEQE
60 70 80 90 100
STSTATKAPP QIKRNVASEI TSVGKVIYEA TWDAKNSKNL SSQVKSGTTG
110 120 130 140 150
EIVVRTATTP SSGPPKESKD KDKDDDKDKE QEQPKSKREQ MRDNVQEYIF
160 170 180 190 200
TRYFNYVKNY DKVLEKNFPK AMQLYRVFFE GVKDFFADMK RFLKISRIAN
210 220 230 240 250
HAPQGIRALN RQELELYMQM PRDMMKVAPA LIGCSLPMVG YAFFPLVFWY
260 270 280 290 300
PRIFLTPHFW TEPQRIEFQK YYTKRRLQCN KSVLRCLQAK LKQVEGHHKY
310 320 330 340 350
AEFEAILGQL GSGTHPTPEA LISVKDIFAE GPYSLLGMSR KHVKCLVKMH
360 370 380 390 400
GLPNSLFKRH RLHEHAFLVH FMDMAITREG GVHNLSLASL RYSCCLRGLN
410 420 430 440 450
PDDLSAEEMI DWLRKWVKVS TSIQGEHITL FLHLPVLLGY NHPNNWKTIY

CNKTP
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again