Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_B5YG29 50S ribosomal protein L15 n=80 RepID=RL15_THEYD MKINDLKPAPGSKKKAKRIGRGLGSGHGRYATKGLKGQKSRSGGAKGAGFEGGQMPLQRR VPKRGFSNAPFKKEYAIVNLEDLNKIIDEVDIITPETLLQKGIVKDLKDGLKILGNGEIK KSITVKTNAISKSALQKIQSVGGKVEVI

Members

List component clusters with 100% or 90% identity.
1 to 25 of 80  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B5YG29RL15_THEYD50S ribosomal protein L15Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)289376UniRef100_B5YG29
UniRef90_B5YG29
148Representative
Q39XY7RL15_GEOMG50S ribosomal protein L15Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)269799UniRef100_Q39XY7
UniRef90_Q39XY7
148
A0A3N1VFT1A0A3N1VFT1_9DELT50S ribosomal protein L15Desulfosoma caldarium610254UniRef100_A0A3N1VFT1
UniRef90_A0A3N1VFT1
147
A0A352JP77A0A352JP77_9BACT50S ribosomal protein L15candidate division Zixibacteria bacterium2053527UniRef100_A0A352JP77
UniRef90_A0A352JP77
147
A0A1G1HA31A0A1G1HA31_9BACT50S ribosomal protein L15Nitrospirae bacterium RBG_19FT_COMBO_55_121801710UniRef100_A0A1G1HA31
UniRef90_A0A1G1HA31
146
A0A1Q7Z9T8A0A1Q7Z9T8_9DELT50S ribosomal protein L15Deltaproteobacteria bacterium 13_1_20CM_2_69_211805109UniRef100_A0A1Q7Z9T8
UniRef90_A0A1Q7Z9T8
175Seed
A0A1Q7PA06A0A1Q7PA06_9DELT50S ribosomal protein L15Myxococcales bacterium 13_1_40CM_2_68_151805256UniRef100_A0A1Q7Z9T8
UniRef90_A0A1Q7Z9T8
175
A0A1Q7EWM0A0A1Q7EWM0_9DELT50S ribosomal protein L15Deltaproteobacteria bacterium 13_1_40CM_68_241805123UniRef100_A0A1Q7Z9T8
UniRef90_A0A1Q7Z9T8
175
A0A1Q7JQP7A0A1Q7JQP7_9DELT50S ribosomal protein L15Deltaproteobacteria bacterium 13_1_40CM_4_68_191805121UniRef100_A0A1Q7Z9T8
UniRef90_A0A1Q7Z9T8
175
A0A2H6F0J0A0A2H6F0J0_9BACT50S ribosomal protein L15bacterium BMS3Abin062005714UniRef100_A0A2H6F0J0
UniRef90_A0A2H6F0J0
145
A0A3D4MXU9A0A3D4MXU9_9FIRM50S ribosomal protein L15Clostridiales bacterium1898207UniRef100_A0A3D4MXU9
UniRef90_A0A3D4MXU9
146
A0A1W1V6N9A0A1W1V6N9_9THEO50S ribosomal protein L15Thermanaeromonas toyohensis ToBE698762UniRef100_A0A1W1V6N9
UniRef90_A0A1W1V6N9
146
A0A356APH8A0A356APH8_9FIRM50S ribosomal protein L15Ruminococcaceae bacterium1898205UniRef100_A0A356APH8
UniRef90_A0A356APH8
146
A0A352I4B9A0A352I4B9_9FIRM50S ribosomal protein L15 (Fragment)Ruminococcaceae bacterium1898205UniRef100_A0A352I4B9
UniRef90_A0A356APH8
140
I4BV40I4BV40_ACEMN50S ribosomal protein L15Acetomicrobium mobile (strain ATCC BAA-54 / DSM 13181 / JCM 12221 / NGA) (Acetomicrobium mobile)891968UniRef100_I4BV40
UniRef90_I4BV40
148
A0A0S8EE90A0A0S8EE90_9BACT50S ribosomal protein L15Nitrospira bacterium SM23_351704026UniRef100_A0A0S8EE90
UniRef90_A0A0S8EE90
146
A0A1G0LKY2A0A1G0LKY2_9DELT50S ribosomal protein L15Geobacteraceae bacterium GWB2_52_121798314UniRef100_A0A1G0LKY2
UniRef90_A0A1G0LKY2
147
R6MVY9R6MVY9_9CLOT50S ribosomal protein L15Clostridium leptum CAG:271263068UniRef100_R6MVY9
UniRef90_R6MVY9
146
A0A1C6G1B8A0A1C6G1B8_9FIRM50S ribosomal protein L15uncultured Ruminococcus sp.165186UniRef100_R6MVY9
UniRef90_R6MVY9
146
A0A412R7D5A0A412R7D5_9FIRM50S ribosomal protein L15[Clostridium] leptum1535UniRef100_R6MVY9
UniRef90_R6MVY9
146
A7VR34A7VR34_9FIRM50S ribosomal protein L15[Clostridium] leptum DSM 753428125UniRef100_R6MVY9
UniRef90_R6MVY9
146
A0A412AVE1A0A412AVE1_9FIRM50S ribosomal protein L15[Clostridium] leptum1535UniRef100_A0A412AVE1
UniRef90_R6MVY9
146
A0A2V8VCC9A0A2V8VCC9_9BACT50S ribosomal protein L15Acidobacteria bacterium1978231UniRef100_A0A2V8VCC9
UniRef90_A0A2V8VCC9
152
A0A2U3LV29A0A2U3LV29_9BACT50S ribosomal protein L15Candidatus Sulfopaludibacter sp. SbA42043165UniRef100_A0A2U3LV29
UniRef90_A0A2U3LV29
148
A0A3C1UX36A0A3C1UX36_9FIRM50S ribosomal protein L15Ruminococcaceae bacterium1898205UniRef100_A0A3C1UX36
UniRef90_A0A3C1UX36
146

Sequence

Representative sequenceiLengthMass (Da)Tools
B5YG29

Checksumi: C750276BDA9A15E8

FASTA14815,848
        10         20         30         40         50
MKINDLKPAP GSKKKAKRIG RGLGSGHGRY ATKGLKGQKS RSGGAKGAGF
60 70 80 90 100
EGGQMPLQRR VPKRGFSNAP FKKEYAIVNL EDLNKIIDEV DIITPETLLQ
110 120 130 140
KGIVKDLKDG LKILGNGEIK KSITVKTNAI SKSALQKIQS VGGKVEVI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again