Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_B8B7S5 Protein BZR1 homolog 1 n=166 Tax=Mesangiospermae TaxID=1437183 RepID=BZR1_ORYSI MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALC REAGWVVEDDGTTYRKGCKPPPSSAGGASVGMSPCSSTQLLSAPSSSFPSPVPSYHASPA SSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWD VDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTY NLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK

Members

List component clusters with 100% or 90% identity.
1 to 25 of 166  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B8B7S5BZR1_ORYSIProtein BZR1 homolog 1Oryza sativa subsp. indica (Rice)39946UniRef100_B8B7S5
UniRef90_B8B7S5
298Representative
Q7XI96BZR1_ORYSJProtein BZR1 homolog 1Oryza sativa subsp. japonica (Rice)39947UniRef100_B8B7S5
UniRef90_B8B7S5
298
C5XCF5C5XCF5_SORBIBES1_N domain-containing proteinSorghum bicolor (Sorghum) (Sorghum vulgare)4558UniRef100_C5XCF5
UniRef90_B8B7S5
336
A0A3L6FZC7A0A3L6FZC7_MAIZEProtein BZR1 1Zea mays (Maize)4577UniRef100_A0A3L6FZC7
UniRef90_B8B7S5
331
A0A1E5UX51A0A1E5UX51_9POALProtein BZR1-like protein 1Dichanthelium oligosanthes888268UniRef100_A0A1E5UX51
UniRef90_B8B7S5
329
K3ZV77K3ZV77_SETITBES1_N domain-containing proteinSetaria italica (Foxtail millet) (Panicum italicum)4555UniRef100_K3ZV77
UniRef90_B8B7S5
326
A0A4U6W2H9A0A4U6W2H9_SETVIBES1_N domain-containing proteinSetaria viridis (Green bristlegrass) (Setaria italica subsp. viridis)4556UniRef100_K3ZV77
UniRef90_B8B7S5
326
A0A1D6EZJ8A0A1D6EZJ8_MAIZEProtein BRASSINAZOLE-RESISTANT 1Zea mays (Maize)4577UniRef100_A0A1D6EZJ8
UniRef90_B8B7S5
324
A0A3L6TE71A0A3L6TE71_PANMIBES1_N domain-containing proteinPanicum miliaceum (Proso millet) (Broomcorn millet)4540UniRef100_A0A3L6TE71
UniRef90_B8B7S5
324
A0A2T7EXU3A0A2T7EXU3_9POALBES1_N domain-containing proteinPanicum hallii var. hallii1504633UniRef100_A0A2T7EXU3
UniRef90_B8B7S5
324
A0A2S3H3M2A0A2S3H3M2_9POALBES1_N domain-containing proteinPanicum hallii206008UniRef100_A0A2T7EXU3
UniRef90_B8B7S5
324
A0A3L6QWH1A0A3L6QWH1_PANMIBES1_N domain-containing proteinPanicum miliaceum (Proso millet) (Broomcorn millet)4540UniRef100_A0A3L6QWH1
UniRef90_B8B7S5
324
A0A2G9GUC0A0A2G9GUC0_9LAMIBES1_N domain-containing proteinHandroanthus impetiginosus429701UniRef100_A0A2G9GUC0
UniRef90_A0A2G9GUC0
315
A0A1Q3AV71A0A1Q3AV71_CEPFODUF822 domain-containing proteinCephalotus follicularis (Albany pitcher plant)3775UniRef100_A0A1Q3AV71
UniRef90_A0A1Q3AV71
312
A0A484KJY3A0A484KJY3_9ASTEBES1_N domain-containing proteinCuscuta campestris132261UniRef100_A0A484KJY3
UniRef90_A0A484NT52
319
A0A328D5R3A0A328D5R3_9ASTEBES1_N domain-containing proteinCuscuta australis267555UniRef100_A0A484KJY3
UniRef90_A0A484NT52
319
A0A484NT52A0A484NT52_9ASTEBES1_N domain-containing proteinCuscuta campestris132261UniRef100_A0A484NT52
UniRef90_A0A484NT52
319
A0A103YCI6A0A103YCI6_CYNCSBZR1, transcriptional repressorCynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus)59895UniRef100_A0A103YCI6
UniRef90_A0A103YCI6
306
A0A2C9U014A0A2C9U014_MANESBES1_N domain-containing proteinManihot esculenta (Cassava) (Jatropha manihot)3983UniRef100_A0A2C9U014
UniRef90_A0A067L2Y7
312
A0A067L2Y7A0A067L2Y7_JATCUBES1_N domain-containing proteinJatropha curcas (Barbados nut)180498UniRef100_A0A067L2Y7
UniRef90_A0A067L2Y7
312
A0A1J7G643A0A1J7G643_LUPANBES1_N domain-containing proteinLupinus angustifolius (Narrow-leaved blue lupine)3871UniRef100_A0A1J7G643
UniRef90_A0A1J7G643
309
A0A4S8K7T9A0A4S8K7T9_MUSBABES1_N domain-containing proteinMusa balbisiana (Banana)52838UniRef100_A0A4S8K7T9
UniRef90_A0A4S8K7T9
381Seed
A0A3S3LVG3A0A3S3LVG3_9MAGNBES1/BZR1 protein 2Cinnamomum micranthum f. kanehirae337451UniRef100_A0A3S3LVG3
UniRef90_A0A3S3LVG3
318
A0A438GP99A0A438GP99_VITVIBES1/BZR1-like protein 2Vitis vinifera (Grape)29760UniRef100_A0A438GP99
UniRef90_A0A438GP99
316
F6GWZ2F6GWZ2_VITVIBES1_N domain-containing proteinVitis vinifera (Grape)29760UniRef100_A0A438GP99
UniRef90_A0A438GP99
316

Sequence

Representative sequenceiLengthMass (Da)Tools
B8B7S5

Checksumi: 407B51633EF06C80

FASTA29831,909
        10         20         30         40         50
MTSGAAAAGR TPTWKERENN KRRERRRRAI AAKIFTGLRA LGNYNLPKHC
60 70 80 90 100
DNNEVLKALC REAGWVVEDD GTTYRKGCKP PPSSAGGASV GMSPCSSTQL
110 120 130 140 150
LSAPSSSFPS PVPSYHASPA SSSFPSPSRI DNPSASCLLP FLRGLPNLPP
160 170 180 190 200
LRVSSSAPVT PPLSSPTASR PPKIRKPDWD VDPFRHPFFA VSAPASPTRG
210 220 230 240 250
RRLEHPDTIP ECDESDVSTV DSGRWISFQM ATTAPTSPTY NLVNPGASTS
260 270 280 290
NSMEIEGTAG RGGAEFEFDK GRVTPWEGER IHEVAAEELE LTLGVGAK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again