Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_C5CC48 50S ribosomal protein L6 n=1370 RepID=RL6_MICLC MSRIGRLPITIPAGVDVTIDGDRVSVKGPKGQLEHSLPTPITATLEEGQVTVARPDDERE SRSLHGLTRTLISNMVEGVTNGFSKQLEVVGTGYRVQAKGQDLEFALGYSHPVPVKAPQG ITFTVEGNRVTVAGIDKQQVGETAANIRKLRRPDPYKGKGVRYAGEQIRRKAGKAGK

Members

List component clusters with 100% or 90% identity.
1 to 25 of 1,370  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
C5CC48RL6_MICLC50S ribosomal protein L6Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) (Micrococcus lysodeikticus)465515UniRef100_C5CC48
UniRef90_C5CC48
177Representative
P33099RL6_MICLU50S ribosomal protein L6Micrococcus luteus (Micrococcus lysodeikticus)1270UniRef100_P33099
UniRef90_C5CC48
178
Q1MPQ0RL6_LAWIP50S ribosomal protein L6Lawsonia intracellularis (strain PHE/MN1-00)363253UniRef100_Q1MPQ0
UniRef90_Q1MPQ0
181
B1VEX0RL6_CORU750S ribosomal protein L6Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)504474UniRef100_B1VEX0
UniRef90_B1VEX0
178
Q7V531RL6_PROMM50S ribosomal protein L6Prochlorococcus marinus (strain MIT 9313)74547UniRef100_Q7V531
UniRef90_Q7V531
179
B3E0J9RL6_METI450S ribosomal protein L6Methylacidiphilum infernorum (isolate V4) (Methylokorus infernorum (strain V4))481448UniRef100_B3E0J9
UniRef90_B3E0J9
179
Q3AMP4RL6_SYNSC50S ribosomal protein L6Synechococcus sp. (strain CC9605)110662UniRef100_Q3AMP4
UniRef90_Q3AW79
181
Q3AW79RL6_SYNS950S ribosomal protein L6Synechococcus sp. (strain CC9902)316279UniRef100_Q3AW79
UniRef90_Q3AW79
179
Q7U4I6RL6_SYNPX50S ribosomal protein L6Synechococcus sp. (strain WH8102)84588UniRef100_Q7U4I6
UniRef90_Q3AW79
179
Q8KAI6RL6_CHLTE50S ribosomal protein L6Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum)194439UniRef100_Q8KAI6
UniRef90_Q8KAI6
179
A2BYS2RL6_PROM550S ribosomal protein L6Prochlorococcus marinus (strain MIT 9515)167542UniRef100_A2BYS2
UniRef90_Q7UZV8
179
Q7UZV8RL6_PROMP50S ribosomal protein L6Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)59919UniRef100_Q7UZV8
UniRef90_Q7UZV8
179
B1YGW5RL6_EXIS250S ribosomal protein L6Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)262543UniRef100_B1YGW5
UniRef90_B1YGW5
178
B0SA32RL6_LEPBA50S ribosomal protein L6Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)355278UniRef100_B0SA32
UniRef90_B0SA32
179
B0SSG3RL6_LEPBP50S ribosomal protein L6Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)456481UniRef100_B0SA32
UniRef90_B0SA32
179
B8DW28RL6_BIFA050S ribosomal protein L6Bifidobacterium animalis subsp. lactis (strain AD011)442563UniRef100_B8DW28
UniRef90_B8DW28
179
B0RZS4RL6_FINM250S ribosomal protein L6Finegoldia magna (strain ATCC 29328) (Peptostreptococcus magnus)334413UniRef100_B0RZS4
UniRef90_B0RZS4
179
Q2JQN4RL6_SYNJA50S ribosomal protein L6Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)321327UniRef100_Q2JQN4
UniRef90_Q2JQN4
181
A6W5V3RL6_KINRD50S ribosomal protein L6Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)266940UniRef100_A6W5V3
UniRef90_A6W5V3
179
Q2LQC2RL6_SYNAS50S ribosomal protein L6Syntrophus aciditrophicus (strain SB)56780UniRef100_Q2LQC2
UniRef90_Q2LQC2
179
A9BCN3RL6_PROM450S ribosomal protein L6Prochlorococcus marinus (strain MIT 9211)93059UniRef100_A9BCN3
UniRef90_A9BCN3
179
Q46IS3RL6_PROMT50S ribosomal protein L6Prochlorococcus marinus (strain NATL2A)59920UniRef100_Q46IS3
UniRef90_Q46IS3
179
A2C4Y5RL6_PROM150S ribosomal protein L6Prochlorococcus marinus (strain NATL1A)167555UniRef100_A2C4Y5
UniRef90_Q46IS3
179
C4LL11RL6_CORK450S ribosomal protein L6Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)645127UniRef100_C4LL11
UniRef90_C4LL11
178
Q0RRQ6RL6_FRAAA50S ribosomal protein L6Frankia alni (strain ACN14a)326424UniRef100_Q0RRQ6
UniRef90_Q2JFG1
178

Sequence

Representative sequenceiLengthMass (Da)Tools
C5CC48

Checksumi: B9B94D223ED87261

FASTA17719,067
        10         20         30         40         50
MSRIGRLPIT IPAGVDVTID GDRVSVKGPK GQLEHSLPTP ITATLEEGQV
60 70 80 90 100
TVARPDDERE SRSLHGLTRT LISNMVEGVT NGFSKQLEVV GTGYRVQAKG
110 120 130 140 150
QDLEFALGYS HPVPVKAPQG ITFTVEGNRV TVAGIDKQQV GETAANIRKL
160 170
RRPDPYKGKG VRYAGEQIRR KAGKAGK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again