Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_D6RDH7 Stress-70 protein, mitochondrial n=6 Tax=Hominidae TaxID=9604 RepID=D6RDH7_HUMAN MISASRAAAARLVGAAASRGPTAARHQIRSNQGSSCWY

Members

List component clusters with 100% or 90% identity.
1 to 6 of 6  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
D6RDH7D6RDH7_HUMANStress-70 protein, mitochondrialHomo sapiens (Human)9606UniRef100_D6RDH7
UniRef90_D6RDH7
38Representative
A0A2J8LR86A0A2J8LR86_PANTRHSPA9 isoform 6Pan troglodytes (Chimpanzee)9598UniRef100_D6RDH7
UniRef90_D6RDH7
38
A0A2J8VPS7A0A2J8VPS7_PONABHSPA9 isoform 5Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VPS7
UniRef90_D6RDH7
38
A0A2J8VPS1A0A2J8VPS1_PONABHSPA9 isoform 4Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VPS1
UniRef90_D6RCD7
35
D6RCD7D6RCD7_HUMANStress-70 protein, mitochondrialHomo sapiens (Human)9606UniRef100_D6RCD7
UniRef90_D6RCD7
42Seed
A0A2J8LR66A0A2J8LR66_PANTRHSPA9 isoform 5Pan troglodytes (Chimpanzee)9598UniRef100_D6RCD7
UniRef90_D6RCD7
42

Sequence

Representative sequenceiLengthMass (Da)Tools
D6RDH7

Checksumi: E7E51F8A29E866B8

FASTA383,931
        10         20         30 
MISASRAAAA RLVGAAASRG PTAARHQIRS NQGSSCWY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again