Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_E6Y356 Superoxide dismutase [Cu-Zn] n=35 Tax=Opisthokonta TaxID=33154 RepID=E6Y356_KRYMA MVAKAVCVLKGAGDTSGTVHFEQENESAPVRVTGEISGLAPGEHGFHVHAFGDNTNGCIS AGPHYNPFSKNHGGPTDEERHVGDLGNVTAGENNIAKINIEDSFIKLSGPHSIIGRTIVI HEKRDDLGKGGDEESLKTGNAGARLACGVIGIAQ

Members

List component clusters with 100% or 90% identity.
1 to 25 of 35  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
E6Y356E6Y356_KRYMASuperoxide dismutase [Cu-Zn]Kryptolebias marmoratus (Mangrove killifish) (Rivulus marmoratus)37003UniRef100_E6Y356
UniRef90_E6Y356
154Representative
A0A3Q3JWY5A0A3Q3JWY5_MONALSuperoxide dismutase [Cu-Zn]Monopterus albus (Swamp eel)43700UniRef100_A0A3Q3JWY5
UniRef90_A0A3Q3JWY5
154
C3KIP6C3KIP6_ANOFISuperoxide dismutase [Cu-Zn]Anoplopoma fimbria (Sablefish)229290UniRef100_C3KIP6
UniRef90_C3KIP6
154
H3B131H3B131_LATCHSuperoxide dismutase [Cu-Zn]Latimeria chalumnae (Coelacanth)7897UniRef100_H3B131
UniRef90_H3B131
154
A0A3B4AWF0A0A3B4AWF0_9GOBISuperoxide dismutase [Cu-Zn]Periophthalmus magnuspinnatus409849UniRef100_A0A3B4AWF0
UniRef90_A0A3B4AT74
142
A0A3B4AT74A0A3B4AT74_9GOBISuperoxide dismutase [Cu-Zn]Periophthalmus magnuspinnatus409849UniRef100_A0A3B4AT74
UniRef90_A0A3B4AT74
154
A0A3B4ATR2A0A3B4ATR2_9GOBISuperoxide dismutase [Cu-Zn]Periophthalmus magnuspinnatus409849UniRef100_A0A3B4ATR2
UniRef90_A0A3B4AT74
140
A4K522A4K522_BUFGRSuperoxide dismutase [Cu-Zn]Bufo gargarizans (Asian toad) (Bufo bufo gargarizans)30331UniRef100_A4K522
UniRef90_A4K522
150
A0A0L0FS30A0A0L0FS30_9EUKASuperoxide dismutase [Cu-Zn]Sphaeroforma arctica JP610667725UniRef100_A0A0L0FS30
UniRef90_A0A0L0FS30
149
A0A0P5SL45A0A0P5SL45_9CRUSSuperoxide dismutase [Cu-Zn]Daphnia magna35525UniRef100_A0A0P5SL45
UniRef90_A0A0P5SL45
150
C5IYJ1C5IYJ1_9TELESuperoxide dismutase [Cu-Zn]Hemibarbus mylodon (Korean doty barbel)351240UniRef100_C5IYJ1
UniRef90_C5IYJ1
154
A0A125SL96A0A125SL96_STENESuperoxide dismutase [Cu-Zn]Sterechinus neumayeri (Antarctic sea urchin)53479UniRef100_A0A125SL96
UniRef90_A0A125SL96
151
A0A2U9Q3F1A0A2U9Q3F1_9ECHNSuperoxide dismutase [Cu-Zn]Paelopatides sp. YL-20182219783UniRef100_A0A2U9Q3F1
UniRef90_A0A2U9Q3F1
152
A0A2U9IY68A0A2U9IY68_SEBSCSuperoxide dismutase [Cu-Zn]Sebastes schlegelii (Korean rockfish)214486UniRef100_A0A2U9IY68
UniRef90_A0A2U9IY68
154
J3SDD5J3SDD5_CROADSuperoxide dismutase [Cu-Zn]Crotalus adamanteus (Eastern diamondback rattlesnake)8729UniRef100_J3SDD5
UniRef90_J3SDD5
159
A0A1W7RCZ2A0A1W7RCZ2_AGKCOSuperoxide dismutase [Cu-Zn]Agkistrodon contortrix contortrix (Southern copperhead)8713UniRef100_A0A1W7RCZ2
UniRef90_J3SDD5
159
T1DKV7T1DKV7_CROHDSuperoxide dismutase [Cu-Zn]Crotalus horridus (Timber rattlesnake)35024UniRef100_T1DKV7
UniRef90_J3SDD5
159
A0A2L0HIK8A0A2L0HIK8_BRAPCSuperoxide dismutase [Cu-Zn]Brachionus plicatilis (Marine rotifer) (Brachionus muelleri)10195UniRef100_A0A2L0HIK8
UniRef90_A0A3M7T3T5
154
A0A3M7T3T5A0A3M7T3T5_BRAPCSuperoxide dismutase [Cu-Zn]Brachionus plicatilis (Marine rotifer) (Brachionus muelleri)10195UniRef100_A0A3M7T3T5
UniRef90_A0A3M7T3T5
154
A0A0A7DNE9A0A0A7DNE9_9BILASuperoxide dismutase [Cu-Zn]Brachionus koreanus1199090UniRef100_A0A0A7DNE9
UniRef90_A0A3M7T3T5
154
A0A185L2K4A0A185L2K4_ACRFASuperoxide dismutase [Cu-Zn]Acrossocheilus fasciatus (Crossochilus fasciatus)356809UniRef100_A0A185L2K4
UniRef90_A0A185L2K4
154
A0A498LF02A0A498LF02_LABROSuperoxide dismutase [Cu-Zn]Labeo rohita (Indian major carp) (Cyprinus rohita)84645UniRef100_A0A498LF02
UniRef90_A0A185L2K4
154
A0A1W6SA09A0A1W6SA09_9TELESuperoxide dismutase [Cu-Zn]Gymnocypris eckloni (Yellow River scaleless carp)263515UniRef100_A0A1W6SA09
UniRef90_A0A185L2K4
154
A0A0C4FH71A0A0C4FH71_CYPCASuperoxide dismutase [Cu-Zn]Cyprinus carpio 'jian' (Jian carp)749192UniRef100_A0A0C4FH71
UniRef90_A0A185L2K4
154
A0A5A9N3N9A0A5A9N3N9_9TELESuperoxide dismutase [Cu-Zn]Triplophysa tibetana1572043UniRef100_A0A5A9N3N9
UniRef90_A0A5A9N3N9
154

Sequence

Representative sequenceiLengthMass (Da)Tools
E6Y356

Checksumi: 4D3C57F3A0A8E14F

FASTA15415,975
        10         20         30         40         50
MVAKAVCVLK GAGDTSGTVH FEQENESAPV RVTGEISGLA PGEHGFHVHA
60 70 80 90 100
FGDNTNGCIS AGPHYNPFSK NHGGPTDEER HVGDLGNVTA GENNIAKINI
110 120 130 140 150
EDSFIKLSGP HSIIGRTIVI HEKRDDLGKG GDEESLKTGN AGARLACGVI

GIAQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again