Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_G3SFM2 CS domain-containing protein n=25 Tax=Boreoeutheria TaxID=1437010 RepID=G3SFM2_GORGO FGYLIIPPNSDDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFYSIDPNDSKHKRTDRSIL CCLRKGESGQSWPRLTKERAKLNWLSVGFNHWKDWEDGSDEDRSNFDRFSEMMNNMGGDE DVDSPEVDGADDDSQDSDDEKMPDLE

Members

List component clusters with 100% or 90% identity.
1 to 25 of 25  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
G3SFM2G3SFM2_GORGOCS domain-containing proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3SFM2
UniRef90_G3SFM2
146Representative
A0A2I3RQU5A0A2I3RQU5_PANTRCS domain-containing proteinPan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RQU5
UniRef90_G3SFM2
137
A0A2R9C5L8A0A2R9C5L8_PANPACS domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2I3RQU5
UniRef90_G3SFM2
137
A0A2I2ZXU9A0A2I2ZXU9_GORGOCS domain-containing proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2ZXU9
UniRef90_G3SFM2
133
A0A2K6N8L8A0A2K6N8L8_RHIROCS domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6N8L8
UniRef90_A0A2K6N8L8
136
A0A2K6L1R6A0A2K6L1R6_RHIBECS domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6N8L8
UniRef90_A0A2K6N8L8
136
H9Z4J1H9Z4J1_MACMUProstaglandin E synthase 3Macaca mulatta (Rhesus macaque)9544UniRef100_H9Z4J1
UniRef90_H9Z4J1
158
Q5PQL9Q5PQL9_RATProstaglandin E synthase 3-like 1Rattus norvegicus (Rat)10116UniRef100_Q5PQL9
UniRef90_Q5PQL9
149
A0A2K5HFJ7A0A2K5HFJ7_COLAPCS domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HFJ7
UniRef90_A0A2K5HFJ7
137
Q9CRH1Q9CRH1_MOUSECS domain-containing proteinMus musculus (Mouse)10090UniRef100_Q9CRH1
UniRef90_Q9CRH1
140
A0A2K5LE11A0A2K5LE11_CERATCS domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5LE11
UniRef90_A0A2K5LE11
168Seed
A0A2K5LE34A0A2K5LE34_CERATCS domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5LE34
UniRef90_A0A2K5LE11
146
A0A2K6LZC9A0A2K6LZC9_RHIBECS domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6LZC9
UniRef90_A0A2K6LZC9
141
A0A2K6LZ94A0A2K6LZ94_RHIBECS domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6LZ94
UniRef90_A0A2K6LZC9
139
A0A2K5WNX7A0A2K5WNX7_MACFACS domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5WNX7
UniRef90_A0A2I3M2Y8
154
A0A2K6CB30A0A2K6CB30_MACNECS domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K5WNX7
UniRef90_A0A2I3M2Y8
138
A0A2K5YVR9A0A2K5YVR9_MANLECS domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5YVR9
UniRef90_A0A2I3M2Y8
154
A0A2I3M2Y8A0A2I3M2Y8_PAPANCS domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3M2Y8
UniRef90_A0A2I3M2Y8
154
UPI0001FA6AE2prostaglandin E synthase 3-like isoform X1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_UPI0001FA6AE2
UniRef90_G3SFM2
160
UPI0006C99215prostaglandin E synthase 3-likePan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_UPI0006C99215
UniRef90_G3SFM2
128
UPI0005F47731prostaglandin E synthase 3-like isoform X2Colobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_UPI0005F47731
UniRef90_A0A2K5HFJ7
112
UPI000649B40Dprostaglandin E synthase 3 isoform X2Sorex araneus (Eurasian common shrew) (European shrew)42254UniRef100_UPI000649B40D
UniRef90_UPI000649B40D
135
UPI0005123F1Bprostaglandin E synthase 3 isoform X4Pan troglodytes (Chimpanzee)9598UniRef100_UPI0005123F1B
UniRef90_UPI0005123F1B
148
UPI000D5007DAprostaglandin E synthase 3 isoform X5Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_UPI000D5007DA
UniRef90_UPI000D5007DA
135
UPI000D4FFB26prostaglandin E synthase 3 isoform X7Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_UPI000D4FFB26
UniRef90_UPI000D5007DA
131

Sequence

Representative sequenceiLengthMass (Da)Tools
G3SFM2

Checksumi: DE3E602DEE461573

FASTA14616,764
        10         20         30         40         50
FGYLIIPPNS DDVNVNFEKS KLTFSCLGGS DNFKHLNEID LFYSIDPNDS
60 70 80 90 100
KHKRTDRSIL CCLRKGESGQ SWPRLTKERA KLNWLSVGFN HWKDWEDGSD
110 120 130 140
EDRSNFDRFS EMMNNMGGDE DVDSPEVDGA DDDSQDSDDE KMPDLE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again