Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_H0VGD8 Uncharacterized protein n=313 Tax=Gnathostomata TaxID=7776 RepID=H0VGD8_CAVPO MRKPRRKLRQNAEGRRSPSPYSLKCSPTRETLTYAQAQRIVEVDIDGRLHRISIYDPLKI ITEDELTAQDITECNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGAPFHLPQPSFR VMDLGSQPEAPPLPAAYYRYIEKPPEDLDAEVEYDMDEEDLAWLDMVNEKRRADGHSSVS ADTFELLVDRLEKESYLESRSTGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVH QECYGVPYIPEGQWLCRCCLQSPSRPVDCVLCPNKGGAFKQTSDGHWAHVVCAIWIPEVC FANTVFLEPIEGIDNIPPARWKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFM KIEPMRETSLNGTIFTVRKTAYCEAHSPPSATAARKKGSSPGSLSEAGEEEGLKEGGGEE EEEGEEEKEAEHEQQEGQGSVGGPLKAVPKKNKTSVKQKVKKEPEEAGRDTPSTIPVVTV PQIPSYRLNKICSGLSFQRKTQFMQRLHNYWLLKRQARNGVPLIRRLHSHLLSQRNAEQR EQDEKTSAVKEELKYWQKLRHDLERARLLIELIRKREKLKREQVKIQQAAMELELMPFNV LLRTTLDLLQEKDPAHIFAEPVNLSEVPDYLEFISKPMDFSTMRRKLESHLYHTLEEFEE DFNLIVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAENIGYDPERGTHLPESPKL EDFYRFSWEDVDNILIPENRAHLSPEVQLKELLEKLDLVSAMRSSGARTRRVRLLRREIN ALRQKLAQPPPQLPLLNKTVSNGELPVGTRGDTAVPEQVLQEEPDYDGDRDDSKLPPPPT LEPTGPAPSLSEQESPPDPPTLKPISDSKPPSRFLKPRKAEEDELLEKSPLQLGSEPLQH LLSDNGLNRLSLMAPDSPADAPLSGVGRRTSVLFKKAKNGVKLQRGPDGALENGEDPGVA GSPASPASIEEEHRSRKRPRSRSGSESEGERSLQQEEETGVTNGFGKHTESGSDSECSLG LSSGLAFDTCSGLTPPKRSRGKPALSRVPFLEGMNGDTDYSGSGRSLLMPFEDRGDLEPL ELVWAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVL FFDNKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRGPH SFVASSYL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 313  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
H0VGD8H0VGD8_CAVPOUncharacterized proteinCavia porcellus (Guinea pig)10141UniRef100_H0VGD8
UniRef90_H0VGD8
1,208Representative
L9KTW0L9KTW0_TUPCHBromodomain and PHD finger-containing protein 3Tupaia chinensis (Chinese tree shrew)246437UniRef100_L9KTW0
UniRef90_H0VGD8
1,330Seed
A0A5E4AV14A0A5E4AV14_MARMOUncharacterized proteinMarmota monax (Woodchuck)9995UniRef100_L9KTW0
UniRef90_H0VGD8
107
A0A1S3AFT7A0A1S3AFT7_ERIEUbromodomain and PHD finger-containing protein 3 isoform X1Erinaceus europaeus (Western European hedgehog)9365UniRef100_A0A1S3AFT7
UniRef90_H0VGD8
1,211
A0A2K5X8V6A0A2K5X8V6_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5X8V6
UniRef90_H0VGD8
1,205
A0A2R9C169A0A2R9C169_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9C169
UniRef90_H0VGD8
1,204
L5L0L2L5L0L2_PTEALBromodomain and PHD finger-containing protein 3Pteropus alecto (Black flying fox)9402UniRef100_L5L0L2
UniRef90_H0VGD8
1,082
A0A096NHR7A0A096NHR7_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A096NHR7
UniRef90_A0A096NHR7
1,205
A8WI61A8WI61_HUMANBromodomain and PHD finger-containing protein 3 (Fragment)Homo sapiens (Human)9606UniRef100_A0A096NHR7
UniRef90_A0A096NHR7
129
A0A2J8Y3H2A0A2J8Y3H2_PONABBRPF3 isoform 7 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A096NHR7
UniRef90_A0A096NHR7
129
A0A2J8NZ63A0A2J8NZ63_PANTRBRPF3 isoform 6 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A096NHR7
UniRef90_A0A096NHR7
129
A0A4W3JX20A0A4W3JX20_CALMIUncharacterized proteinCallorhinchus milii (Ghost shark)7868UniRef100_A0A4W3JX20
UniRef90_A0A4W3JX20
1,193
A0A2I3LLR5A0A2I3LLR5_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3LLR5
UniRef90_A0A2I3LLR5
1,119
A0A402EJX7A0A402EJX7_9SAURUncharacterized proteinParoedura picta143630UniRef100_A0A402EJX7
UniRef90_A0A402EJX7
1,160
A0A3Q3A766A0A3Q3A766_KRYMAUncharacterized proteinKryptolebias marmoratus (Mangrove killifish) (Rivulus marmoratus)37003UniRef100_A0A3Q3A766
UniRef90_A0A2I4BDJ0
1,163
A0A3Q2ZSB3A0A3Q2ZSB3_KRYMAUncharacterized proteinKryptolebias marmoratus (Mangrove killifish) (Rivulus marmoratus)37003UniRef100_A0A3Q2ZSB3
UniRef90_A0A2I4BDJ0
1,250
A0A2I4BDJ0A0A2I4BDJ0_9TELEbromodomain and PHD finger-containing protein 3-likeAustrofundulus limnaeus52670UniRef100_A0A2I4BDJ0
UniRef90_A0A2I4BDJ0
1,241
A0A2K5VVC2A0A2K5VVC2_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5VVC2
UniRef90_A0A2K5VVC2
1,119
A0A2K6QWW1A0A2K6QWW1_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K5VVC2
UniRef90_A0A2K5VVC2
1,119
A0A2K5ZT73A0A2K5ZT73_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5VVC2
UniRef90_A0A2K5VVC2
1,119
A0A2K6KTS6A0A2K6KTS6_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K5VVC2
UniRef90_A0A2K5VVC2
1,119
A0A2K5IQE1A0A2K5IQE1_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5VVC2
UniRef90_A0A2K5VVC2
1,119
A0A2K5NT75A0A2K5NT75_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5NT75
UniRef90_A0A2K5VVC2
1,119
H9GNQ2H9GNQ2_ANOCAUncharacterized proteinAnolis carolinensis (Green anole) (American chameleon)28377UniRef100_H9GNQ2
UniRef90_H9GNQ2
1,160
G3NMF1G3NMF1_GASACBromodomain and PHD finger containing, 3bGasterosteus aculeatus (Three-spined stickleback)69293UniRef100_G3NMF1
UniRef90_G3NMF1
1,198

Sequence

Representative sequenceiLengthMass (Da)Tools
H0VGD8

Checksumi: 16F00796CE15AAC8

FASTA1,208135,651
        10         20         30         40         50
MRKPRRKLRQ NAEGRRSPSP YSLKCSPTRE TLTYAQAQRI VEVDIDGRLH
60 70 80 90 100
RISIYDPLKI ITEDELTAQD ITECNSNKEN SEQPQFPGKS KKPSSKGKKK
110 120 130 140 150
ESCSKHASGA PFHLPQPSFR VMDLGSQPEA PPLPAAYYRY IEKPPEDLDA
160 170 180 190 200
EVEYDMDEED LAWLDMVNEK RRADGHSSVS ADTFELLVDR LEKESYLESR
210 220 230 240 250
STGAQQSLID EDAFCCVCLD DECHNSNVIL FCDICNLAVH QECYGVPYIP
260 270 280 290 300
EGQWLCRCCL QSPSRPVDCV LCPNKGGAFK QTSDGHWAHV VCAIWIPEVC
310 320 330 340 350
FANTVFLEPI EGIDNIPPAR WKLTCYICKQ KGLGAAIQCH KVNCYTAFHV
360 370 380 390 400
TCAQRAGLFM KIEPMRETSL NGTIFTVRKT AYCEAHSPPS ATAARKKGSS
410 420 430 440 450
PGSLSEAGEE EGLKEGGGEE EEEGEEEKEA EHEQQEGQGS VGGPLKAVPK
460 470 480 490 500
KNKTSVKQKV KKEPEEAGRD TPSTIPVVTV PQIPSYRLNK ICSGLSFQRK
510 520 530 540 550
TQFMQRLHNY WLLKRQARNG VPLIRRLHSH LLSQRNAEQR EQDEKTSAVK
560 570 580 590 600
EELKYWQKLR HDLERARLLI ELIRKREKLK REQVKIQQAA MELELMPFNV
610 620 630 640 650
LLRTTLDLLQ EKDPAHIFAE PVNLSEVPDY LEFISKPMDF STMRRKLESH
660 670 680 690 700
LYHTLEEFEE DFNLIVTNCM KYNAKDTIFH RAAVRLRDLG GAILRHARRQ
710 720 730 740 750
AENIGYDPER GTHLPESPKL EDFYRFSWED VDNILIPENR AHLSPEVQLK
760 770 780 790 800
ELLEKLDLVS AMRSSGARTR RVRLLRREIN ALRQKLAQPP PQLPLLNKTV
810 820 830 840 850
SNGELPVGTR GDTAVPEQVL QEEPDYDGDR DDSKLPPPPT LEPTGPAPSL
860 870 880 890 900
SEQESPPDPP TLKPISDSKP PSRFLKPRKA EEDELLEKSP LQLGSEPLQH
910 920 930 940 950
LLSDNGLNRL SLMAPDSPAD APLSGVGRRT SVLFKKAKNG VKLQRGPDGA
960 970 980 990 1000
LENGEDPGVA GSPASPASIE EEHRSRKRPR SRSGSESEGE RSLQQEEETG
1010 1020 1030 1040 1050
VTNGFGKHTE SGSDSECSLG LSSGLAFDTC SGLTPPKRSR GKPALSRVPF
1060 1070 1080 1090 1100
LEGMNGDTDY SGSGRSLLMP FEDRGDLEPL ELVWAKCRGY PSYPALIIDP
1110 1120 1130 1140 1150
KMPREGLLHN GVPIPVPPLD VLKLGEQKQA EAGEKLFLVL FFDNKRTWQW
1160 1170 1180 1190 1200
LPRDKVLPLG VEDTVDKLKM LEGRKTSIRK SVQVAYDRAM IHLSRVRGPH

SFVASSYL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again