Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_H2NFH7 Coatomer subunit delta n=39 Tax=Tetrapoda TaxID=32523 RepID=H2NFH7_PONAB MIPEYCRALEENEISEHCFDLIFAFDEIVALGYRENVNLAQIRTFTEMDSHEEKVFRAVR ETQEREAKAEMRRKAKELQQARRDAERQGKKAPGFGGFGSSAVSGGSTAAMITETIIETD KPKVAPAPARPSGPSKALKLGAKGKEVDNFVDKLKSEGETIMSSSMGKRTSEASKMHAPP INMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQ THPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNG CDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAK NKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKY EIL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 39  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
H2NFH7H2NFH7_PONABCoatomer subunit deltaPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NFH7
UniRef90_H2NFH7
423Representative
A0A2K5Z8Y9A0A2K5Z8Y9_MANLECoatomer subunit deltaMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5Z8Y9
UniRef90_H2NFH7
426
A0A2K5PDL9A0A2K5PDL9_CEBCACoatomer subunit deltaCebus capucinus imitator1737458UniRef100_A0A2K5PDL9
UniRef90_H2NFH7
423
A0A337SD75A0A337SD75_FELCACoatomer subunit deltaFelis catus (Cat) (Felis silvestris catus)9685UniRef100_A0A337SD75
UniRef90_H2NFH7
423
F6S2S4F6S2S4_CALJACoatomer subunit deltaCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F6S2S4
UniRef90_H2NFH7
423
A0A2U3YDK6A0A2U3YDK6_LEPWECoatomer subunit deltaLeptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A2U3YDK6
UniRef90_H2NFH7
423
A0A2R8ZRQ8A0A2R8ZRQ8_PANPACoatomer subunit deltaPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R8ZRQ8
UniRef90_H2NFH7
423
A0A2I3NDZ8A0A2I3NDZ8_PAPANCoatomer subunit deltaPapio anubis (Olive baboon)9555UniRef100_A0A2I3NDZ8
UniRef90_H2NFH7
423
F7GX10F7GX10_MACMUCoatomer subunit deltaMacaca mulatta (Rhesus macaque)9544UniRef100_A0A2I3NDZ8
UniRef90_H2NFH7
423
A0A2K5NIT1A0A2K5NIT1_CERATCoatomer subunit deltaCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2I3NDZ8
UniRef90_H2NFH7
423
A0A2K5Z8W7A0A2K5Z8W7_MANLECoatomer subunit deltaMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2I3NDZ8
UniRef90_H2NFH7
423
A0A2K5UMQ5A0A2K5UMQ5_MACFACoatomer subunit deltaMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2I3NDZ8
UniRef90_H2NFH7
423
A0A3Q0E518A0A3Q0E518_TARSYCoatomer subunit deltaTarsius syrichta (Philippine tarsier)1868482UniRef100_A0A3Q0E518
UniRef90_H2NFH7
423
A0A340XBI1A0A340XBI1_LIPVECoatomer subunit deltaLipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340XBI1
UniRef90_H2NFH7
423
A0A2K5ECG4A0A2K5ECG4_AOTNACoatomer subunit deltaAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5ECG4
UniRef90_H2NFH7
423
A0A2K6RKC2A0A2K6RKC2_RHIROCoatomer subunit deltaRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RKC2
UniRef90_H2NFH7
423
A0A2K6M812A0A2K6M812_RHIBECoatomer subunit deltaRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6RKC2
UniRef90_H2NFH7
423
A0A2K6G198A0A2K6G198_PROCOCoatomer subunit deltaPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6G198
UniRef90_H2NFH7
423
A0A2U3WTG0A0A2U3WTG0_ODOROCoatomer subunit deltaOdobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3WTG0
UniRef90_H2NFH7
423
K7CTJ3K7CTJ3_PANTRCoatomer subunit deltaPan troglodytes (Chimpanzee)9598UniRef100_K7CTJ3
UniRef90_H2NFH7
423
A0A2I2Z1Z0A0A2I2Z1Z0_GORGOCoatomer subunit deltaGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_K7CTJ3
UniRef90_H2NFH7
423
P48444-2Isoform 2 of COPD_HUMAN2Homo sapiens (Human)9606UniRef100_K7CTJ3
UniRef90_H2NFH7
423
A0A2I3HWW0A0A2I3HWW0_NOMLECoatomer subunit deltaNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3HWW0
UniRef90_H2NFH7
363
G1R717G1R717_NOMLECoatomer subunit deltaNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1R717
UniRef90_A0A2I3GNJ9
451
A0A2I3GNJ9A0A2I3GNJ9_NOMLECoatomer subunit deltaNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3GNJ9
UniRef90_A0A2I3GNJ9
492

Sequence

Representative sequenceiLengthMass (Da)Tools
H2NFH7

Checksumi: D3695C17D77D3AD2

FASTA42347,190
        10         20         30         40         50
MIPEYCRALE ENEISEHCFD LIFAFDEIVA LGYRENVNLA QIRTFTEMDS
60 70 80 90 100
HEEKVFRAVR ETQEREAKAE MRRKAKELQQ ARRDAERQGK KAPGFGGFGS
110 120 130 140 150
SAVSGGSTAA MITETIIETD KPKVAPAPAR PSGPSKALKL GAKGKEVDNF
160 170 180 190 200
VDKLKSEGET IMSSSMGKRT SEASKMHAPP INMESVHMKI EEKITLTCGR
210 220 230 240 250
DGGLQNMELH GMIMLRISDD KYGRIRLHVE NEDKKGVQLQ THPNVDKKLF
260 270 280 290 300
TAESLIGLKN PEKSFPVNSD VGVLKWRLQT TEESFIPLTI NCWPSESGNG
310 320 330 340 350
CDVNIEYELQ EDNLELNDVV ITIPLPSGVG APVIGEIDGE YRHDSRRNTL
360 370 380 390 400
EWCLPVIDAK NKSGSLEFSI AGQPNDFFPV QVSFVSKKNY CNIQVTKVTQ
410 420
VDGNSPVRFS TETTFLVDKY EIL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again