Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_O15819 Histone H3.3 type a n=37 RepID=H33A_DICDI MARTKQTARKSTGAKVPRKHIGSKQAHKQTPVSSSSGGVKKVHRFRPGTVALREIRKYQK STDLLIRKLPFQRLVREIAQEFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR VTIMPKDIHLARRIRGERS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 37  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O15819H33A_DICDIHistone H3.3 type aDictyostelium discoideum (Slime mold)44689UniRef100_O15819
UniRef90_O15819
139Representative
Q55BN9H33B_DICDIHistone H3.3 type bDictyostelium discoideum (Slime mold)44689UniRef100_Q55BN9
UniRef90_Q55BN9
136
Q55BP0H33C_DICDIHistone H3.3 type cDictyostelium discoideum (Slime mold)44689UniRef100_Q55BP0
UniRef90_Q55BP0
136
F0ZA16F0ZA16_DICPUHistone H3Dictyostelium purpureum (Slime mold)5786UniRef100_F0ZA16
UniRef90_O15819
140
A0A151ZE59A0A151ZE59_9MYCEH3a, histone H3Tieghemostelium lacteum361077UniRef100_A0A151ZE59
UniRef90_O15819
138
F4QCS7F4QCS7_CAVFAHistone H3Cavenderia fasciculata (strain SH3) (Slime mold) (Dictyostelium fasciculatum)1054147UniRef100_F4QCS7
UniRef90_O15819
137
F1A4E1F1A4E1_DICPUHistone H3Dictyostelium purpureum (Slime mold)5786UniRef100_F1A4E1
UniRef90_Q55BN9
139
A0A152A8S9A0A152A8S9_9MYCEH3b, histone H3Tieghemostelium lacteum361077UniRef100_A0A152A8S9
UniRef90_Q55BN9
135
A0A0F9EEQ3A0A0F9EEQ3_9ZZZZHistone domain-containing proteinmarine sediment metagenome412755UniRef100_A0A0F9EEQ3
UniRef90_A0A0F9EEQ3
144
A0A194QS67A0A194QS67_PAPMAHistone H3.3Papilio machaon (Old World swallowtail butterfly)76193UniRef100_A0A194QS67
UniRef90_A0A194QS67
129
Q5TEC6Q5TEC6_HUMANHistone H3Homo sapiens (Human)9606UniRef100_Q5TEC6
UniRef90_Q5TEC6
136
D0VT02D0VT02_SELLIHistone H3 (Fragment)Selenops lindborgi (Wall crab spider)686584UniRef100_Q5TEC6
UniRef90_Q5TEC6
70
Q64528Q64528_MUSPAHistone H3Mus pahari (Gairdner's shrew-mouse) (Coelomys pahari)10093UniRef100_Q64528
UniRef90_Q5TEC6
136
Q6WV79Q6WV79_MYTCHHistone H3Mytilus chilensis (Chilean blue mussel)173667UniRef100_Q6WV79
UniRef90_Q5TEC6
136
A0A0G2QMM9A0A0G2QMM9_9TELEHistone H3 (Fragment)Zenion sp. RH 91195601UniRef100_A0A0G2QMM9
UniRef90_Q5TEC6
110
A0A1L6CCR1A0A1L6CCR1_9GASTHistone H3 (Fragment)Eubranchus sp. A DS-20161920071UniRef100_A0A1L6CCR1
UniRef90_Q5TEC6
109
G0ZHR7G0ZHR7_9BILAHistone H3 (Fragment)Argonemertes australiensis210790UniRef100_G0ZHR7
UniRef90_Q5TEC6
109
A0A1L2F4V9A0A1L2F4V9_9ANNEHistone H3 (Fragment)Hormogaster sp. 2 DFM-20161880973UniRef100_A0A1L2F4V9
UniRef90_Q5TEC6
109
D3BUT3D3BUT3_POLPPHistone H3Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) (Heterostelium pallidum)670386UniRef100_D3BUT3
UniRef90_F4PS01
135
F4PS01F4PS01_CAVFAHistone H3Cavenderia fasciculata (strain SH3) (Slime mold) (Dictyostelium fasciculatum)1054147UniRef100_F4PS01
UniRef90_F4PS01
137
A0A453QJB0A0A453QJB0_AEGTSHistone domain-containing proteinAegilops tauschii subsp. strangulata (Goatgrass)200361UniRef100_A0A453QJB0
UniRef90_A0A453QJB0
129
A0A287BKF7A0A287BKF7_PIGHistone H3Sus scrofa (Pig)9823UniRef100_A0A287BKF7
UniRef90_A0A287BKF7
129
A0A067P544A0A067P544_9AGAMHistone domain-containing protein (Fragment)Jaapia argillacea MUCL 33604933084UniRef100_A0A067P544
UniRef90_A0A067P544
135
A0A2R7WPB3A0A2R7WPB3_ONCFAHistone H3.2Oncopeltus fasciatus (Large milkweed bug)7536UniRef100_A0A2R7WPB3
UniRef90_A0A2R7WPB3
130
A7J3Y5A7J3Y5_9NEOPHistone 3 (Fragment)Paratropes sp. 1 DJGI-2006406674UniRef100_A0A2R7WPB3
UniRef90_A0A2R7WPB3
109

Sequence

Representative sequenceiLengthMass (Da)Tools
O15819

Checksumi: CD472AAAAD419B5E

FASTA13915,702
        10         20         30         40         50
MARTKQTARK STGAKVPRKH IGSKQAHKQT PVSSSSGGVK KVHRFRPGTV
60 70 80 90 100
ALREIRKYQK STDLLIRKLP FQRLVREIAQ EFKTDLRFQS AAIGALQEAS
110 120 130
EAYLVGLFED TNLCAIHAKR VTIMPKDIHL ARRIRGERS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again