Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_O16797 60S ribosomal protein L3 n=437 Tax=cellular organisms TaxID=131567 RepID=RL3_DROME MSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREA DRPGSKINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYK NWYKSKKKAFTKASKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIKQRQKKAHV MEIQLNGGSIEDKVKWAREHLEKPIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWHTKKL PRKTHKGLRKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVIK NNASTEYDLTDKSITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLRKSLLKHTKRSAL EQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLKKDRLKEEAAATTAAAAAATTTSA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 437  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O16797RL3_DROME60S ribosomal protein L3Drosophila melanogaster (Fruit fly)7227UniRef100_O16797
UniRef90_O16797
416Representative
P34113RL3_DICDI60S ribosomal protein L3Dictyostelium discoideum (Slime mold)44689UniRef100_P34113
UniRef90_P34113
398
C6SUV6C6SUV6_DROMELP14077p (Fragment)Drosophila melanogaster (Fruit fly)7227UniRef100_O16797
UniRef90_O16797
418
B4QU67B4QU67_DROSIGD18739Drosophila simulans (Fruit fly)7240UniRef100_O16797
UniRef90_O16797
416
A0A4P2V7B0A0A4P2V7B0_9MUSCRibosomal protein L3 (Fragment)Drosophila pseudotakahashii193234UniRef100_O16797
UniRef90_O16797
229
A0A4P2VFG9A0A4P2VFG9_DROJARibosomal protein L3 (Fragment)Drosophila jambulina (Fruit fly)111875UniRef100_O16797
UniRef90_O16797
228
A0A4P2V781A0A4P2V781_DROAVRibosomal protein L3 (Fragment)Drosophila auraria (Fruit fly)47315UniRef100_O16797
UniRef90_O16797
228
A0A1I8N656A0A1I8N656_MUSDOUncharacterized proteinMusca domestica (House fly)7370UniRef100_A0A1I8N656
UniRef90_O16797
440
A0A1W4ULZ1A0A1W4ULZ1_DROFC60S ribosomal protein L3 isoform X1Drosophila ficusphila (Fruit fly)30025UniRef100_A0A1W4ULZ1
UniRef90_O16797
416
B4PLI8B4PLI8_DROYAUncharacterized protein, isoform ADrosophila yakuba (Fruit fly)7245UniRef100_B4PLI8
UniRef90_O16797
416
B3NZH5B3NZH5_DROERGG17978Drosophila erecta (Fruit fly)7220UniRef100_B3NZH5
UniRef90_O16797
416
B4GLH0B4GLH0_DROPEGL12566Drosophila persimilis (Fruit fly)7234UniRef100_B4GLH0
UniRef90_O16797
415
A0A4P2V8L0A0A4P2V8L0_9MUSCRibosomal protein L3 (Fragment)Drosophila tsukubaensis77130UniRef100_B4GLH0
UniRef90_O16797
221
A0A4P2V790A0A4P2V790_DROBFRibosomal protein L3 (Fragment)Drosophila bifasciata (Fruit fly)7218UniRef100_B4GLH0
UniRef90_O16797
215
A0A4P2VAI9A0A4P2VAI9_9MUSCRibosomal protein L3 (Fragment)Drosophila hubeiensis57873UniRef100_B4GLH0
UniRef90_O16797
217
A0A4P2V8I6A0A4P2V8I6_DROALRibosomal protein L3 (Fragment)Drosophila algonquin (Fruit fly)7247UniRef100_B4GLH0
UniRef90_O16797
216
A0A4P2V7A2A0A4P2V7A2_DROMDRibosomal protein L3 (Fragment)Drosophila madeirensis (Fruit fly)30013UniRef100_B4GLH0
UniRef90_O16797
216
A0A4P2VFG3A0A4P2VFG3_DROAZRibosomal protein L3 (Fragment)Drosophila azteca (Fruit fly)7249UniRef100_B4GLH0
UniRef90_O16797
224
A0A4V0P084A0A4V0P084_DROAIRibosomal protein L3 (Fragment)Drosophila affinis (Fruit fly)7246UniRef100_B4GLH0
UniRef90_O16797
224
A0A4P2VBA8A0A4P2VBA8_DROATRibosomal protein L3 (Fragment)Drosophila athabasca (Fruit fly)7248UniRef100_B4GLH0
UniRef90_O16797
217
A0A0M4EM74A0A0M4EM74_DROBSRpL3Drosophila busckii (Fruit fly)30019UniRef100_A0A0M4EM74
UniRef90_O16797
415
B4LZI6B4LZI6_DROVIUncharacterized protein, isoform ADrosophila virilis (Fruit fly)7244UniRef100_B4LZI6
UniRef90_O16797
415
B4KD01B4KD01_DROMOUncharacterized protein, isoform ADrosophila mojavensis (Fruit fly)7230UniRef100_B4KD01
UniRef90_O16797
415
A0A484AXU5A0A484AXU5_DRONAUncharacterized proteinDrosophila navojoa (Fruit fly)7232UniRef100_B4KD01
UniRef90_O16797
415
B3LZ56B3LZ56_DROANUncharacterized protein, isoform ADrosophila ananassae (Fruit fly)7217UniRef100_B3LZ56
UniRef90_O16797
415

Sequence

Representative sequenceiLengthMass (Da)Tools
O16797

Checksumi: 779D843982334AA5

FASTA41646,916
        10         20         30         40         50
MSHRKFSAPR HGSMAFYPKK RSARHRGKVK AFPKDDASKP VHLTCFIGYK
60 70 80 90 100
AGMTHIVREA DRPGSKINKK EVVEAVTVLE TPPMIVVGAV GYIETPFGLR
110 120 130 140 150
ALVNVWAQHL SEECRRRFYK NWYKSKKKAF TKASKKWTDD LGKKSIENDF
160 170 180 190 200
RKMLRYCKVI RVIAHSQIRL IKQRQKKAHV MEIQLNGGSI EDKVKWAREH
210 220 230 240 250
LEKPIQVSNV FGQDEMIDCV GVTKGKGFKG VTSRWHTKKL PRKTHKGLRK
260 270 280 290 300
VACIGAWHPS RVSTTVARAG QKGYHHRTEI NKKIYRIGAG IHTKDGKVIK
310 320 330 340 350
NNASTEYDLT DKSITPMGGF PHYGEVNNDF VMIKGCCIGS KKRIITLRKS
360 370 380 390 400
LLKHTKRSAL EQIKLKFIDT SSKMGHGRFQ TPADKLAFMG PLKKDRLKEE
410
AAATTAAAAA ATTTSA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again