Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_O43766 Lipoyl synthase, mitochondrial n=288 Tax=Opisthokonta TaxID=33154 RepID=LIAS_HUMAN MSLRCGDAARTLGPRVFGRYFCSPVRPLSSLPDKKKELLQNGPDLQDFVSGDLADRSTWD EYKGNLKRQKGERLRLPPWLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGG GEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDASEPYNTAKAIAEWGLDYVVLTSV DRDDMPDGGAEHIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVET VPELQSKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREAD VDCLTLGQYMQPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFL KNLVAKRKTKDL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 288  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O43766LIAS_HUMANLipoyl synthase, mitochondrialHomo sapiens (Human)9606UniRef100_O43766
UniRef90_O43766
372Representative
Q5BIP7LIAS_BOVINLipoyl synthase, mitochondrialBos taurus (Bovine)9913UniRef100_Q5BIP7
UniRef90_O43766
372
B0WAU6LIAS_CULQULipoyl synthase, mitochondrialCulex quinquefasciatus (Southern house mosquito) (Culex pungens)7176UniRef100_B0WAU6
UniRef90_B0WAU6
380
Q16W22LIAS_AEDAELipoyl synthase, mitochondrialAedes aegypti (Yellowfever mosquito) (Culex aegypti)7159UniRef100_Q16W22
UniRef90_Q16W22
393
Q5XIH4LIAS_RATLipoyl synthase, mitochondrialRattus norvegicus (Rat)10116UniRef100_Q5XIH4
UniRef90_Q5XIH4
373
A0A024R9W0A0A024R9W0_HUMANLipoyl synthase, mitochondrialHomo sapiens (Human)9606UniRef100_O43766
UniRef90_O43766
372
G1SWJ3G1SWJ3_RABITLipoyl synthase, mitochondrialOryctolagus cuniculus (Rabbit)9986UniRef100_G1SWJ3
UniRef90_O43766
374
A0A485NCH6A0A485NCH6_LYNPALipoyl synthase, mitochondrialLynx pardinus (Iberian lynx) (Felis pardina)191816UniRef100_A0A485NCH6
UniRef90_O43766
373
A0A3Q7QCX2A0A3Q7QCX2_CALURLipoyl synthase, mitochondrialCallorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7QCX2
UniRef90_O43766
373
A0A2U3VMF6A0A2U3VMF6_ODOROLipoyl synthase, mitochondrialOdobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3VMF6
UniRef90_O43766
373
E2R257E2R257_CANLFLipoyl synthase, mitochondrialCanis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_E2R257
UniRef90_O43766
373
A0A3Q7T108A0A3Q7T108_VULVULipoyl synthase, mitochondrialVulpes vulpes (Red fox)9627UniRef100_A0A3Q7T108
UniRef90_O43766
373
G1L8X8G1L8X8_AILMELipoyl synthase, mitochondrialAiluropoda melanoleuca (Giant panda)9646UniRef100_G1L8X8
UniRef90_O43766
373
A0A384CYS7A0A384CYS7_URSMALipoyl synthase, mitochondrialUrsus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_A0A384CYS7
UniRef90_O43766
373
A0A3Q7WS49A0A3Q7WS49_URSARLipoyl synthase, mitochondrialUrsus arctos horribilis116960UniRef100_A0A384CYS7
UniRef90_O43766
373
A0A452Q7C6A0A452Q7C6_URSAMLipoyl synthase, mitochondrialUrsus americanus (American black bear) (Euarctos americanus)9643UniRef100_A0A384CYS7
UniRef90_O43766
373
A0A2I2V384A0A2I2V384_FELCALipoyl synthase, mitochondrialFelis catus (Cat) (Felis silvestris catus)9685UniRef100_A0A2I2V384
UniRef90_O43766
373
A0A2Y9HZY0A0A2Y9HZY0_NEOSCLipoyl synthase, mitochondrialNeomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A2Y9HZY0
UniRef90_O43766
373
A0A2U3XLL4A0A2U3XLL4_LEPWELipoyl synthase, mitochondrialLeptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A2U3XLL4
UniRef90_O43766
373
A0A2K6REF1A0A2K6REF1_RHIROLipoyl synthase, mitochondrialRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6REF1
UniRef90_O43766
372
W5PQ59W5PQ59_SHEEPLipoyl synthase, mitochondrialOvis aries (Sheep)9940UniRef100_W5PQ59
UniRef90_O43766
372
H2PD48H2PD48_PONABLipoyl synthase, mitochondrialPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2PD48
UniRef90_O43766
372
L8IJF6L8IJF6_9CETALipoyl synthase, mitochondrialBos mutus (wild yak)72004UniRef100_L8IJF6
UniRef90_O43766
372
G1P2T3G1P2T3_MYOLULipoyl synthase, mitochondrialMyotis lucifugus (Little brown bat)59463UniRef100_G1P2T3
UniRef90_O43766
372
A0A2U3VAH7A0A2U3VAH7_TURTRLipoyl synthase, mitochondrialTursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_A0A2U3VAH7
UniRef90_O43766
372

Sequence

Representative sequenceiLengthMass (Da)Tools
O43766

Checksumi: A5BEACA1F36CEB74

FASTA37241,911
        10         20         30         40         50
MSLRCGDAAR TLGPRVFGRY FCSPVRPLSS LPDKKKELLQ NGPDLQDFVS
60 70 80 90 100
GDLADRSTWD EYKGNLKRQK GERLRLPPWL KTEIPMGKNY NKLKNTLRNL
110 120 130 140 150
NLHTVCEEAR CPNIGECWGG GEYATATATI MLMGDTCTRG CRFCSVKTAR
160 170 180 190 200
NPPPLDASEP YNTAKAIAEW GLDYVVLTSV DRDDMPDGGA EHIAKTVSYL
210 220 230 240 250
KERNPKILVE CLTPDFRGDL KAIEKVALSG LDVYAHNVET VPELQSKVRD
260 270 280 290 300
PRANFDQSLR VLKHAKKVQP DVISKTSIML GLGENDEQVY ATMKALREAD
310 320 330 340 350
VDCLTLGQYM QPTRRHLKVE EYITPEKFKY WEKVGNELGF HYTASGPLVR
360 370
SSYKAGEFFL KNLVAKRKTK DL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again