Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_O43766-3 Isoform 3 of Lipoyl synthase, mitochondrial n=376 Tax=Eukaryota TaxID=2759 RepID=Isoform 3 of LIAS_HUMAN MLTAFRPNSPTAIVVRAASTNAKKLEEIRERLAKGPNFQDFVQNPDNLKSVGENYDGKLR REKGEEQRLRLPPWLKTTIPMGKNYTKIKEQLRELKLSTVCEEARCPNIGECWGGGENGT QTATIMLMGDTCTRGCRFCSVKTARIPPPLDENEPVNTAKAIASWGLDYIVLTSVDRDDL PDGGSKHIAQTVREIKARNSNIFVECLVPDFRGDLDCVETIANCGLDVYAHNIETVEKLT PYVRDRRAHYRQTLRVLTEAKRFNPNLITKSSIMLGLGETDEEIERTMTDLREAGVECLT LGQYMQPTNKHLKVIEYVTPEKFKHWEERGNDLGFLYTASGPLVRSSYKAGEFFISSILA NRKANQSKDSAPKN

Members

List component clusters with 100% or 90% identity.
1 to 25 of 376  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O43766-3Isoform 3 of LIAS_HUMAN3Homo sapiens (Human)9606UniRef100_O43766-3
UniRef90_O43766-3
329Representative
Q2LYK1LIAS_DROPSLipoyl synthase, mitochondrialDrosophila pseudoobscura pseudoobscura (Fruit fly)46245UniRef100_Q2LYK1
UniRef90_Q2LYK1
374
B4PF83LIAS2_DROYALipoyl synthase 2, mitochondrialDrosophila yakuba (Fruit fly)7245UniRef100_B4PF83
UniRef90_Q7JQW6
379
B4IUG3LIAS1_DROYALipoyl synthase 1, mitochondrialDrosophila yakuba (Fruit fly)7245UniRef100_B4IUG3
UniRef90_Q7JQW6
379
B3NIL9LIAS_DROERLipoyl synthase, mitochondrialDrosophila erecta (Fruit fly)7220UniRef100_B3NIL9
UniRef90_Q7JQW6
379
B4IAA7LIAS_DROSELipoyl synthase, mitochondrialDrosophila sechellia (Fruit fly)7238UniRef100_B4IAA7
UniRef90_Q7JQW6
377
Q7JQW6LIAS_DROMELipoyl synthase, mitochondrialDrosophila melanogaster (Fruit fly)7227UniRef100_Q7JQW6
UniRef90_Q7JQW6
377
B3M996LIAS_DROANLipoyl synthase, mitochondrialDrosophila ananassae (Fruit fly)7217UniRef100_B3M996
UniRef90_Q7JQW6
376
Q99M04LIAS_MOUSELipoyl synthase, mitochondrialMus musculus (Mouse)10090UniRef100_Q99M04
UniRef90_Q99M04
373
C5DGZ5LIPA_LACTCLipoyl synthase, mitochondrialLachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) (Yeast) (Kluyveromyces thermotolerans)559295UniRef100_C5DGZ5
UniRef90_C5DGZ5
371
Q6CLS2LIPA_KLULALipoyl synthase, mitochondrialKluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)284590UniRef100_Q6CLS2
UniRef90_Q6CLS2
370
C3Y3G4LIAS_BRAFLLipoyl synthase, mitochondrialBranchiostoma floridae (Florida lancelet) (Amphioxus)7739UniRef100_C3Y3G4
UniRef90_C3Y3G4
376
B4MXR6LIAS_DROWILipoyl synthase, mitochondrialDrosophila willistoni (Fruit fly)7260UniRef100_B4MXR6
UniRef90_B4MXR6
372
B3SBB5LIAS_TRIADLipoyl synthase, mitochondrialTrichoplax adhaerens (Trichoplax reptans)10228UniRef100_B3SBB5
UniRef90_B3SBB5
350
O13642LIPA_SCHPOLipoyl synthase, mitochondrialSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)284812UniRef100_O13642
UniRef90_O13642
370
C5DY71LIPA_ZYGRCLipoyl synthase, mitochondrialZygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)559307UniRef100_C5DY71
UniRef90_C5DY71
386
Q0V6U4LIPA_PHANOLipoyl synthase, mitochondrialPhaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)321614UniRef100_Q0V6U4
UniRef90_Q0V6U4
378
B4J3F3LIAS_DROGRLipoyl synthase, mitochondrialDrosophila grimshawi (Hawaiian fruit fly) (Idiomyia grimshawi)7222UniRef100_B4J3F3
UniRef90_B4J3F3
364
B4KYY0LIAS_DROMOLipoyl synthase, mitochondrialDrosophila mojavensis (Fruit fly)7230UniRef100_B4KYY0
UniRef90_B4J3F3
364
Q6GQ48LIAS_XENLALipoyl synthase, mitochondrialXenopus laevis (African clawed frog)8355UniRef100_Q6GQ48
UniRef90_Q6GQ48
372
I3LZR4I3LZR4_ICTTRLipoyl synthase, mitochondrialIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_I3LZR4
UniRef90_O43766-3
375
M3Y3W1M3Y3W1_MUSPFLipoyl synthase, mitochondrialMustela putorius furo (European domestic ferret) (Mustela furo)9669UniRef100_M3Y3W1
UniRef90_O43766-3
362
A0A2U3ZCI8A0A2U3ZCI8_ODOROLipoyl synthase, mitochondrialOdobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3ZCI8
UniRef90_O43766-3
330
A0A2Y9JPR9A0A2Y9JPR9_ENHLULipoyl synthase, mitochondrialEnhydra lutris kenyoni391180UniRef100_A0A2Y9JPR9
UniRef90_O43766-3
330
A0A1U7URM0A0A1U7URM0_TARSYLipoyl synthase, mitochondrialTarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7URM0
UniRef90_O43766-3
329

Sequence

Representative sequenceiLengthMass (Da)Tools
O43766-3

Checksumi: E27E02B8B2B5A9F7

FASTA37442,118
        10         20         30         40         50
MLTAFRPNSP TAIVVRAAST NAKKLEEIRE RLAKGPNFQD FVQNPDNLKS
60 70 80 90 100
VGENYDGKLR REKGEEQRLR LPPWLKTTIP MGKNYTKIKE QLRELKLSTV
110 120 130 140 150
CEEARCPNIG ECWGGGENGT QTATIMLMGD TCTRGCRFCS VKTARIPPPL
160 170 180 190 200
DENEPVNTAK AIASWGLDYI VLTSVDRDDL PDGGSKHIAQ TVREIKARNS
210 220 230 240 250
NIFVECLVPD FRGDLDCVET IANCGLDVYA HNIETVEKLT PYVRDRRAHY
260 270 280 290 300
RQTLRVLTEA KRFNPNLITK SSIMLGLGET DEEIERTMTD LREAGVECLT
310 320 330 340 350
LGQYMQPTNK HLKVIEYVTP EKFKHWEERG NDLGFLYTAS GPLVRSSYKA
360 370
GEFFISSILA NRKANQSKDS APKN
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again