Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_O67722 50S ribosomal protein L13 n=138 RepID=RL13_AQUAE MKTYRIKPEEVERKWWVVDATGKTLGRLASEIAKILRGKHKPYYQPDVDCGDFVIVINAE KIRVTGKKLEQKKYYWHSRYPGGLKERTLKWMLENKPEEVIRLAVKRMLPKNRLGHRMLK KLKVYRGPEHPHQAQKPQPLEVKA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 138  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O67722RL13_AQUAE50S ribosomal protein L13Aquifex aeolicus (strain VF5)224324UniRef100_O67722
UniRef90_O67722
144Representative
A5D5F6RL13_PELTS50S ribosomal protein L13Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)370438UniRef100_A5D5F6
UniRef90_A5D5F6
144
C1B056RL13_RHOOB50S ribosomal protein L13Rhodococcus opacus (strain B4)632772UniRef100_C1B056
UniRef90_Q0S3D9
147
Q0S3D9RL13_RHOJR50S ribosomal protein L13Rhodococcus jostii (strain RHA1)101510UniRef100_Q0S3D9
UniRef90_Q0S3D9
147
A0A432Q0D3A0A432Q0D3_9AQUI50S ribosomal protein L13Aquifex sp.313370UniRef100_A0A432Q0D3
UniRef90_O67722
144
A0A356J3W8A0A356J3W8_9BACT50S ribosomal protein L13Verrucomicrobia bacterium2026799UniRef100_A0A356J3W8
UniRef90_A0A354R9H7
143
A0A354R9H7A0A354R9H7_9BACT50S ribosomal protein L13Verrucomicrobia bacterium2026799UniRef100_A0A354R9H7
UniRef90_A0A354R9H7
143
A0A2E2VM78A0A2E2VM78_9BACT50S ribosomal protein L13Candidatus Marinimicrobia bacterium2026760UniRef100_A0A2E2VM78
UniRef90_A0A2D8MQP4
142
A0A2D8MQP4A0A2D8MQP4_9BACT50S ribosomal protein L13Candidatus Marinimicrobia bacterium2026760UniRef100_A0A2D8MQP4
UniRef90_A0A2D8MQP4
142
A0A381VD28A0A381VD28_9ZZZZUncharacterized protein (Fragment)marine metagenome408172UniRef100_A0A2D8MQP4
UniRef90_A0A2D8MQP4
81
A0A497E674A0A497E674_9BACT50S ribosomal protein L13Candidatus Aerophobetes bacterium2030807UniRef100_A0A497E674
UniRef90_A0A497E674
142
A0A484HEJ3A0A484HEJ3_9DELT50S ribosomal protein L13uncultured Desulfobacteraceae bacterium218296UniRef100_A0A484HEJ3
UniRef90_A0A484HEJ3
145
A0A1H6M3W9A0A1H6M3W9_9MYCO50S ribosomal protein L13Mycolicibacterium rutilum370526UniRef100_A0A1H6M3W9
UniRef90_A0A139V2B5
147
A0A100ZDF8A0A100ZDF8_9MYCO50S ribosomal protein L13Mycolicibacterium novocastrense59813UniRef100_A0A100ZDF8
UniRef90_A0A139V2B5
147
A0A101BPX4A0A101BPX4_9MYCO50S ribosomal protein L13Mycobacterium sp. IS-15901772286UniRef100_A0A100ZDF8
UniRef90_A0A139V2B5
147
A0A101A7N6A0A101A7N6_9MYCO50S ribosomal protein L13Mycobacterium sp. GA-12851772282UniRef100_A0A101A7N6
UniRef90_A0A139V2B5
147
A0A0M2ZJH2A0A0M2ZJH2_9MYCO50S ribosomal protein L13Mycolicibacterium elephantis81858UniRef100_A0A0M2ZJH2
UniRef90_A0A139V2B5
147
A0A439DWY1A0A439DWY1_9MYCO50S ribosomal protein L13Mycolicibacterium elephantis DSM 443681335622UniRef100_A0A0M2ZJH2
UniRef90_A0A139V2B5
147
A0A1E3R7N1A0A1E3R7N1_MYCFV50S ribosomal protein L13Mycolicibacterium flavescens (Mycobacterium flavescens)1776UniRef100_A0A1E3R7N1
UniRef90_A0A139V2B5
147
A0A139V2B5A0A139V2B5_MYCPH50S ribosomal protein L13Mycolicibacterium phlei DSM 43239 = CCUG 210001226750UniRef100_A0A139V2B5
UniRef90_A0A139V2B5
147
A0A3S5EF64A0A3S5EF64_MYCCH50S ribosomal protein L13Mycobacteroides chelonae (Mycobacterium chelonae)1774UniRef100_A0A139V2B5
UniRef90_A0A139V2B5
147
A0A101BVX2A0A101BVX2_9MYCO50S ribosomal protein L13Mycobacterium sp. GA-11991772287UniRef100_A0A101BVX2
UniRef90_A0A139V2B5
147
A0A3G9GKQ0A0A3G9GKQ0_MYCFV50S ribosomal protein L13Mycolicibacterium flavescens (Mycobacterium flavescens)1776UniRef100_A0A3G9GKQ0
UniRef90_A0A139V2B5
147
A0A1A0V297A0A1A0V297_9MYCO50S ribosomal protein L13Mycobacterium sp. 852014-52144_SCH53723361834115UniRef100_A0A3G9GKQ0
UniRef90_A0A139V2B5
147
A0A117JM04A0A117JM04_9MYCO50S ribosomal protein L13Mycobacterium lehmannii2048550UniRef100_A0A3G9GKQ0
UniRef90_A0A139V2B5
147

Sequence

Representative sequenceiLengthMass (Da)Tools
O67722

Checksumi: 6FC089657A6764FC

FASTA14417,068
        10         20         30         40         50
MKTYRIKPEE VERKWWVVDA TGKTLGRLAS EIAKILRGKH KPYYQPDVDC
60 70 80 90 100
GDFVIVINAE KIRVTGKKLE QKKYYWHSRY PGGLKERTLK WMLENKPEEV
110 120 130 140
IRLAVKRMLP KNRLGHRMLK KLKVYRGPEH PHQAQKPQPL EVKA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again