Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_O70477 Homeobox protein PKNOX1 n=553 Tax=Euteleostomi TaxID=117571 RepID=PKNX1_MOUSE MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSDPDAEGVSPPPIESQTPMDADKQAIYR HPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKDGKPFFCEDPETDNLMVK AIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAI TGTLSPQGIVVPASALQQGNVTMATVAGGTVYQPVTVVTPQGQVVTQALSPGTIRIQNSQ LQLQLNQDLSILHQEDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTN LTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKPAQNRPVQRFWPDSLASGVAQATPS ELAMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEDEGGALA PTHISGLVLENSDSLQ

Members

List component clusters with 100% or 90% identity.
1 to 25 of 553  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O70477PKNX1_MOUSEHomeobox protein PKNOX1Mus musculus (Mouse)10090UniRef100_O70477
UniRef90_O70477
436Representative
P55347PKNX1_HUMANHomeobox protein PKNOX1Homo sapiens (Human)9606UniRef100_P55347
UniRef90_P55347
436
Q2HJ84PKNX1_BOVINHomeobox protein PKNOX1Bos taurus (Bovine)9913UniRef100_Q2HJ84
UniRef90_P55347
436
F6QYX9F6QYX9_MONDOHomeobox domain-containing proteinMonodelphis domestica (Gray short-tailed opossum)13616UniRef100_F6QYX9
UniRef90_O70477
439
H0WN77H0WN77_OTOGAPBX/knotted 1 homeobox 1Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby)30611UniRef100_H0WN77
UniRef90_O70477
438
A0A2D4L6U0A0A2D4L6U0_9SAURHomeobox domain-containing proteinMicrurus paraensis1970185UniRef100_A0A2D4L6U0
UniRef90_O70477
437
G1NP19G1NP19_MELGAPBX/knotted 1 homeobox 1Meleagris gallopavo (Wild turkey)9103UniRef100_G1NP19
UniRef90_O70477
437
G1PQW3G1PQW3_MYOLUHomeobox domain-containing proteinMyotis lucifugus (Little brown bat)59463UniRef100_G1PQW3
UniRef90_O70477
436
A0A1S3G1Y9A0A1S3G1Y9_DIPORhomeobox protein PKNOX1 isoform X1Dipodomys ordii (Ord's kangaroo rat)10020UniRef100_A0A1S3G1Y9
UniRef90_O70477
436
L5KDC6L5KDC6_PTEALHomeobox protein PKNOX1Pteropus alecto (Black flying fox)9402UniRef100_L5KDC6
UniRef90_O70477
436
A0A091DZ94A0A091DZ94_FUKDAHomeobox protein PKNOX1Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis)885580UniRef100_A0A091DZ94
UniRef90_O70477
436
H9EQE4H9EQE4_MACMUHomeobox protein PKNOX1Macaca mulatta (Rhesus macaque)9544UniRef100_H9EQE4
UniRef90_O70477
436
G7P067G7P067_MACFAPBX/knotted homeobox 1Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_H9EQE4
UniRef90_O70477
436
I3LWN1I3LWN1_ICTTRHomeobox domain-containing proteinIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_I3LWN1
UniRef90_O70477
436
Q5BJP1Q5BJP1_RATPBX/knotted 1 homeobox 1Rattus norvegicus (Rat)10116UniRef100_Q5BJP1
UniRef90_O70477
436
G3WWP3G3WWP3_SARHAHomeobox domain-containing proteinSarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius)9305UniRef100_G3WWP3
UniRef90_O70477
436
A0A4X2M889A0A4X2M889_VOMURHomeobox domain-containing proteinVombatus ursinus (Common wombat)29139UniRef100_G3WWP3
UniRef90_O70477
436
G5B2V1G5B2V1_HETGAHomeobox protein PKNOX1Heterocephalus glaber (Naked mole rat)10181UniRef100_G5B2V1
UniRef90_O70477
436
A0A0P6JBG7A0A0P6JBG7_HETGAHomeobox protein PKNOX1Heterocephalus glaber (Naked mole rat)10181UniRef100_A0A0P6JBG7
UniRef90_O70477
435
A0A287ATL2A0A287ATL2_PIGHomeobox domain-containing proteinSus scrofa (Pig)9823UniRef100_A0A287ATL2
UniRef90_O70477
435
A0A2R8ZY31A0A2R8ZY31_PANPAHomeobox domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R8ZY31
UniRef90_O70477
435
V8PDP2V8PDP2_OPHHAHomeobox protein PKNOX1 (Fragment)Ophiophagus hannah (King cobra) (Naja hannah)8665UniRef100_V8PDP2
UniRef90_O70477
434
G1KB23G1KB23_ANOCAHomeobox domain-containing proteinAnolis carolinensis (Green anole) (American chameleon)28377UniRef100_G1KB23
UniRef90_O70477
433
F7FIV4F7FIV4_MACMUHomeobox domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7FIV4
UniRef90_O70477
420
G1TE48G1TE48_RABITPBX/knotted 1 homeobox 1Oryctolagus cuniculus (Rabbit)9986UniRef100_G1TE48
UniRef90_O70477
317

Sequence

Representative sequenceiLengthMass (Da)Tools
O70477

Checksumi: AC549642781DFCA0

FASTA43647,538
        10         20         30         40         50
MMATQTLSID SYQDGQQMQV VTELKTEQDP NCSDPDAEGV SPPPIESQTP
60 70 80 90 100
MDADKQAIYR HPLFPLLALL FEKCEQSTQG SEGTTSASFD VDIENFVRKQ
110 120 130 140 150
EKDGKPFFCE DPETDNLMVK AIQVLRIHLL ELEKVNELCK DFCSRYIACL
160 170 180 190 200
KTKMNSETLL SGEPGSPYSP VQSQQIQSAI TGTLSPQGIV VPASALQQGN
210 220 230 240 250
VTMATVAGGT VYQPVTVVTP QGQVVTQALS PGTIRIQNSQ LQLQLNQDLS
260 270 280 290 300
ILHQEDGSSK NKRGVLPKHA TNVMRSWLFQ HIGHPYPTED EKKQIAAQTN
310 320 330 340 350
LTLLQVNNWF INARRRILQP MLDSSCSETP KTKKKPAQNR PVQRFWPDSL
360 370 380 390 400
ASGVAQATPS ELAMSEGAVV TITTPVNMNV DSLQSLSSDG ATLAVQQVMM
410 420 430
AGQSEDESVD STEDEGGALA PTHISGLVLE NSDSLQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again