Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_O95402-2 Isoform 2 of Mediator of RNA polymerase II transcription subunit 26 n=5 Tax=Primates TaxID=9443 RepID=Isoform 2 of MED26_HUMAN MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDV RKKTKNEELAKRAKKLPGWQWACRPRGQPPGA

Members

List component clusters with 100% or 90% identity.
1 to 5 of 5  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O95402-2Isoform 2 of MED26_HUMAN2Homo sapiens (Human)9606UniRef100_O95402-2
UniRef90_O95402-2
92Representative
A0A2K5J9G0A0A2K5J9G0_COLAPTFIIS N-terminal domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5J9G0
UniRef90_O95402-2
93Seed
A0A2K6G5A8A0A2K6G5A8_PROCOTFIIS N-terminal domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6G5A8
UniRef90_O95402-2
89
H9F220H9F220_MACMUMediator of RNA polymerase II transcription subunit 26 (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_H9F220
UniRef90_H9F220
92
M0R2Y4M0R2Y4_HUMANMediator of RNA polymerase II transcription subunit 26 (Fragment)Homo sapiens (Human)9606UniRef100_M0R2Y4
UniRef90_M0R2Y4
82

Sequence

Representative sequenceiLengthMass (Da)Tools
O95402-2

Checksumi: 6837BD299DE56B5A

FASTA9210,359
        10         20         30         40         50
MTAAPASPQQ IRDRLLQAID PQSNIRNMVA VLEVISSLEK YPITKEALEE
60 70 80 90
TRLGKLINDV RKKTKNEELA KRAKKLPGWQ WACRPRGQPP GA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again