Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P00359 Glyceraldehyde-3-phosphate dehydrogenase 3 n=3033 RepID=G3P3_YEAST MVRVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSH DDKHIIVDGKKIATYQERDPANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVIT APSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLT ATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSV VDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQ LSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 3,033  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P00359G3P3_YEASTGlyceraldehyde-3-phosphate dehydrogenase 3Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)559292UniRef100_P00359
UniRef90_P00359
332Representative
Q6FSM4G3P2_CANGAGlyceraldehyde-3-phosphate dehydrogenase 2Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)284593UniRef100_Q6FSM4
UniRef90_P00359
332
P00358G3P2_YEASTGlyceraldehyde-3-phosphate dehydrogenase 2Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)559292UniRef100_P00358
UniRef90_P00359
332
Q9HGY7G3P_ASPORGlyceraldehyde-3-phosphate dehydrogenaseAspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)510516UniRef100_Q9HGY7
UniRef90_Q9HGY7
338
P34920G3PC_CHOCRGlyceraldehyde-3-phosphate dehydrogenase, cytosolicChondrus crispus (Carrageen Irish moss) (Polymorpha crispa)2769UniRef100_P34920
UniRef90_P34920
335
P49433G3P1_SYNY3Glyceraldehyde-3-phosphate dehydrogenase 1Synechocystis sp. (strain PCC 6803 / Kazusa)1111708UniRef100_P49433
UniRef90_P49433
339
Q9Y796G3P_CUTCUGlyceraldehyde-3-phosphate dehydrogenaseCutaneotrichosporon curvatus (Oleaginous yeast) (Cryptococcus curvatus)57679UniRef100_Q9Y796
UniRef90_Q9Y796
337
P32638G3P_SCHCOGlyceraldehyde-3-phosphate dehydrogenaseSchizophyllum commune (Split gill fungus)5334UniRef100_P32638
UniRef90_P32638
337
Q92243G3P_LYOSHGlyceraldehyde-3-phosphate dehydrogenaseLyophyllum shimeji (Hon-shimeji) (Tricholoma shimeji)47721UniRef100_Q92243
UniRef90_Q92243
337
P53429G3P1_GIAINGlyceraldehyde-3-phosphate dehydrogenase 1Giardia intestinalis (Giardia lamblia)5741UniRef100_P53429
UniRef90_P53429
337
P87197G3P_HYPATGlyceraldehyde-3-phosphate dehydrogenaseHypocrea atroviridis (Trichoderma atroviride)63577UniRef100_P87197
UniRef90_P87197
338
P34924G3PC_PINSYGlyceraldehyde-3-phosphate dehydrogenase, cytosolicPinus sylvestris (Scots pine)3349UniRef100_P34924
UniRef90_P34924
340
Q41595G3PC_TAXBAGlyceraldehyde-3-phosphate dehydrogenase, cytosolicTaxus baccata (English yew)25629UniRef100_Q41595
UniRef90_P34924
340
Q39769G3PC_GINBIGlyceraldehyde-3-phosphate dehydrogenase, cytosolicGinkgo biloba (Ginkgo) (Maidenhair tree)3311UniRef100_Q39769
UniRef90_P34924
340
Q6BMK0G3P_DEBHAGlyceraldehyde-3-phosphate dehydrogenaseDebaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)284592UniRef100_Q6BMK0
UniRef90_Q6BMK0
335
P10097G3PC_TRYBBGlyceraldehyde-3-phosphate dehydrogenase, cytosolicTrypanosoma brucei brucei5702UniRef100_P10097
UniRef90_P10097
331
Q01982G3P_PHACHGlyceraldehyde-3-phosphate dehydrogenasePhanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)5306UniRef100_Q01982
UniRef90_Q01982
337
Q96UF1G3P3_MUCCLGlyceraldehyde-3-phosphate dehydrogenase 3Mucor circinelloides f. lusitanicus (Mucor racemosus var. lusitanicus)29924UniRef100_Q96UF1
UniRef90_Q96UF1
339
O16027G3P1_GLOROGlyceraldehyde-3-phosphate dehydrogenase 1 (Fragment)Globodera rostochiensis (Golden nematode worm) (Heterodera rostochiensis)31243UniRef100_O16027
UniRef90_O16027
324
P17729G3P1_TRIKOGlyceraldehyde-3-phosphate dehydrogenase 1Trichoderma koningii (Hypocrea koningii)97093UniRef100_P17729
UniRef90_P17729
336
P19089G3P_CRYPAGlyceraldehyde-3-phosphate dehydrogenaseCryphonectria parasitica (Chestnut blight fungus) (Endothia parasitica)5116UniRef100_P19089
UniRef90_P19089
337
Q9N655G3P_MASBAGlyceraldehyde-3-phosphate dehydrogenaseMastigamoeba balamuthi (Phreatamoeba balamuthi)108607UniRef100_Q9N655
UniRef90_Q9N655
339
P84998G3P1_KLUMAGlyceraldehyde-3-phosphate dehydrogenase 1Kluyveromyces marxianus (Yeast) (Candida kefyr)4911UniRef100_P84998
UniRef90_P84998
329
P32637G3P_PODASGlyceraldehyde-3-phosphate dehydrogenasePodospora anserina (Pleurage anserina)5145UniRef100_P32637
UniRef90_P32637
337
P04970G3P1_CAEELGlyceraldehyde-3-phosphate dehydrogenase 1Caenorhabditis elegans6239UniRef100_P04970
UniRef90_P04970
341

Sequence

Representative sequenceiLengthMass (Da)Tools
P00359

Checksumi: 6CFFFEE7061BC36F

FASTA33235,747
        10         20         30         40         50
MVRVAINGFG RIGRLVMRIA LSRPNVEVVA LNDPFITNDY AAYMFKYDST
60 70 80 90 100
HGRYAGEVSH DDKHIIVDGK KIATYQERDP ANLPWGSSNV DIAIDSTGVF
110 120 130 140 150
KELDTAQKHI DAGAKKVVIT APSSTAPMFV MGVNEEKYTS DLKIVSNASC
160 170 180 190 200
TTNCLAPLAK VINDAFGIEE GLMTTVHSLT ATQKTVDGPS HKDWRGGRTA
210 220 230 240 250
SGNIIPSSTG AAKAVGKVLP ELQGKLTGMA FRVPTVDVSV VDLTVKLNKE
260 270 280 290 300
TTYDEIKKVV KAAAEGKLKG VLGYTEDAVV SSDFLGDSHS SIFDASAGIQ
310 320 330
LSPKFVKLVS WYDNEYGYST RVVDLVEHVA KA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again