Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P01579 Interferon gamma n=156 Tax=Eutheria TaxID=9347 RepID=IFNG_HUMAN MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Members

List component clusters with 100% or 90% identity.
1 to 25 of 156  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P01579IFNG_HUMANInterferon gammaHomo sapiens (Human)9606UniRef100_P01579
UniRef90_P01579
166Representative
Q865Y4IFNG_PAPANInterferon gammaPapio anubis (Olive baboon)9555UniRef100_Q865Y4
UniRef90_P01579
165
P63309IFNG_MACFAInterferon gammaMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_P63309
UniRef90_P01579
165
P63310IFNG_MACMUInterferon gammaMacaca mulatta (Rhesus macaque)9544UniRef100_P63309
UniRef90_P01579
165
P63311IFNG_MACNEInterferon gammaMacaca nemestrina (Pig-tailed macaque)9545UniRef100_P63309
UniRef90_P01579
165
P42162IFNG_CERATInterferon gammaCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_P42162
UniRef90_P01579
165
Q5I6S9IFNG_MACTHInterferon gammaMacaca thibetana (Pere David's macaque) (Tibetan macaque)54602UniRef100_Q5I6S9
UniRef90_P01579
165
Q9TTB0IFNG_PANTRInterferon gamma (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_Q9TTB0
UniRef90_P01579
143
P42160IFNG_HORSEInterferon gammaEquus caballus (Horse)9796UniRef100_P42160
UniRef90_P42160
166
O77763IFNG_EQUASInterferon gammaEquus asinus (Donkey) (Equus africanus asinus)9793UniRef100_O77763
UniRef90_P42160
166
Q1WM28IFNG_DASNOInterferon gammaDasypus novemcinctus (Nine-banded armadillo)9361UniRef100_Q1WM28
UniRef90_Q1WM28
167
P17773IFNG_SHEEPInterferon gammaOvis aries (Sheep)9940UniRef100_P17773
UniRef90_P07353
166
Q8SPW9IFNG_BUBBUInterferon gammaBubalus bubalis (Domestic water buffalo)89462UniRef100_Q8SPW9
UniRef90_P07353
166
Q647G2IFNG_MOSBEInterferon gammaMoschus berezovskii (Chinese forest musk deer)68408UniRef100_Q647G2
UniRef90_P07353
166
P28333IFNG_CERELInterferon gammaCervus elaphus (Red deer)9860UniRef100_P28333
UniRef90_P07353
166
Q2PE75IFNG_BUBCAInterferon gammaBubalus carabanensis (Swamp type water buffalo) (Bubalus bubalis carabanensis)346063UniRef100_Q2PE75
UniRef90_P07353
166
P79154IFNG_CAPHIInterferon gammaCapra hircus (Goat)9925UniRef100_P79154
UniRef90_P07353
166
Q866Y6IFNG_BOSINInterferon gammaBos indicus (Zebu)9915UniRef100_Q866Y6
UniRef90_P07353
166
P07353IFNG_BOVINInterferon gammaBos taurus (Bovine)9913UniRef100_P07353
UniRef90_P07353
166
Q865X1IFNG_LAMGLInterferon gammaLama glama (Llama)9844UniRef100_Q865X1
UniRef90_Q865X1
166
Q865W6IFNG_CAMBAInterferon gammaCamelus bactrianus (Bactrian camel)9837UniRef100_Q865W6
UniRef90_Q865X1
166
P30123IFNG_RABITInterferon gammaOryctolagus cuniculus (Rabbit)9986UniRef100_P30123
UniRef90_P30123
167
P46402IFNG_FELCAInterferon gammaFelis catus (Cat) (Felis silvestris catus)9685UniRef100_P46402
UniRef90_P46402
167
P17803IFNG_PIGInterferon gammaSus scrofa (Pig)9823UniRef100_P17803
UniRef90_P17803
166
G3QT96G3QT96_GORGOInterferon gammaGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_P01579
UniRef90_P01579
166

Sequence

Representative sequenceiLengthMass (Da)Tools
P01579

Checksumi: 1514E8F785FD81AA

FASTA16619,348
        10         20         30         40         50
MKYTSYILAF QLCIVLGSLG CYCQDPYVKE AENLKKYFNA GHSDVADNGT
60 70 80 90 100
LFLGILKNWK EESDRKIMQS QIVSFYFKLF KNFKDDQSIQ KSVETIKEDM
110 120 130 140 150
NVKFFNSNKK KRDDFEKLTN YSVTDLNVQR KAIHELIQVM AELSPAAKTG
160
KRKRSQMLFR GRRASQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again