Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P01732 T-cell surface glycoprotein CD8 alpha chain n=54 Tax=Primates TaxID=9443 RepID=CD8A_HUMAN MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 54  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P01732CD8A_HUMANT-cell surface glycoprotein CD8 alpha chainHomo sapiens (Human)9606UniRef100_P01732
UniRef90_P01732
235Representative
P01732-3Isoform 3 of CD8A_HUMAN3Homo sapiens (Human)9606UniRef100_P01732
UniRef90_P01732
276
Q6ZVS2Q6ZVS2_HUMANcDNA FLJ42162 fis, clone THYMU2005303, highly similar to T-CELL SURFACE GLYCOPROTEIN CD8 ALPHA CHAINHomo sapiens (Human)9606UniRef100_P01732
UniRef90_P01732
152
A0A2K5KJD8A0A2K5KJD8_CERATCD8a moleculeCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5KJD8
UniRef90_P01732
276
A0A2K5XMP0A0A2K5XMP0_MANLECD8a moleculeMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5KJD8
UniRef90_P01732
235
A0A0D9RUY6A0A0D9RUY6_CHLSBCD8a moleculeChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RUY6
UniRef90_P01732
276
A0A096N5A0A0A096N5A0_PAPANCD8a moleculePapio anubis (Olive baboon)9555UniRef100_A0A096N5A0
UniRef90_P01732
276
F7DXL7F7DXL7_MACMUCD8a moleculeMacaca mulatta (Rhesus macaque)9544UniRef100_F7DXL7
UniRef90_P01732
269
A0A2I2ZXG0A0A2I2ZXG0_GORGOCD8a moleculeGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2ZXG0
UniRef90_P01732
236
Q8TAW8Q8TAW8_HUMANCD8a moleculeHomo sapiens (Human)9606UniRef100_Q8TAW8
UniRef90_P01732
235
A0A2J8RNV0A0A2J8RNV0_PONABCD8A isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8RNV0
UniRef90_P01732
235
A0A2K6QL02A0A2K6QL02_RHIROCD8a moleculeRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6QL02
UniRef90_P01732
235
A0A2K6L3T8A0A2K6L3T8_RHIBECD8a moleculeRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6QL02
UniRef90_P01732
235
F7DXK3F7DXK3_MACMUCD8a moleculeMacaca mulatta (Rhesus macaque)9544UniRef100_F7DXK3
UniRef90_P01732
235
A0A2K5ULI8A0A2K5ULI8_MACFACD8a moleculeMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F7DXK3
UniRef90_P01732
235
A0A2J8L5Y2A0A2J8L5Y2_PANTRCD8A isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8L5Y2
UniRef90_P01732
235
A0A2K6B9H6A0A2K6B9H6_MACNECD8a moleculeMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6B9H6
UniRef90_P01732
235
Q96QR6Q96QR6_HUMANMutant CD8 alpha antigenHomo sapiens (Human)9606UniRef100_Q96QR6
UniRef90_P01732
235
G1QRH2G1QRH2_NOMLECD8a moleculeNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1QRH2
UniRef90_P01732
235
A0A2K5JBI6A0A2K5JBI6_COLAPCD8a moleculeColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5JBI6
UniRef90_P01732
235
G3QN43G3QN43_GORGOCD8a moleculeGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QN43
UniRef90_P01732
226
A0A2I3H7J1A0A2I3H7J1_NOMLECD8a moleculeNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3H7J1
UniRef90_P01732
226
A0A2I3RRV7A0A2I3RRV7_PANTRCD8a moleculePan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RRV7
UniRef90_P01732
226
A0A2R9CEN0A0A2R9CEN0_PANPACD8a moleculePan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2I3RRV7
UniRef90_P01732
226
A0A2K5JBA8A0A2K5JBA8_COLAPCD8a moleculeColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5JBA8
UniRef90_P01732
198

Sequence

Representative sequenceiLengthMass (Da)Tools
P01732

Checksumi: FCCA29BAA73726BB

FASTA23525,729
        10         20         30         40         50
MALPVTALLL PLALLLHAAR PSQFRVSPLD RTWNLGETVE LKCQVLLSNP
60 70 80 90 100
TSGCSWLFQP RGAAASPTFL LYLSQNKPKA AEGLDTQRFS GKRLGDTFVL
110 120 130 140 150
TLSDFRRENE GYYFCSALSN SIMYFSHFVP VFLPAKPTTT PAPRPPTPAP
160 170 180 190 200
TIASQPLSLR PEACRPAAGG AVHTRGLDFA CDIYIWAPLA GTCGVLLLSL
210 220 230
VITLYCNHRN RRRVCKCPRP VVKSGDKPSL SARYV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again