Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P02452 Collagen alpha-1(I) chain n=389 Tax=cellular organisms TaxID=131567 RepID=CO1A1_HUMAN MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRI CVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPR GPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGP MGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGR PGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQ MGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGP RGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGP QGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGL PGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGL TGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGV PGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGE QGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGS QGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGD KGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGP PGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGP AGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGV VGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGA EGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPTGPVGP VGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGP RGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF LPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCR DLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKD KRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQ TGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPII DVAPLDVGAPDQEFGFDVGPVCFL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 389  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P02452CO1A1_HUMANCollagen alpha-1(I) chainHomo sapiens (Human)9606UniRef100_P02452
UniRef90_P02452
1,464Representative
P02453CO1A1_BOVINCollagen alpha-1(I) chainBos taurus (Bovine)9913UniRef100_P02453
UniRef90_P02453
1,463
P02457CO1A1_CHICKCollagen alpha-1(I) chainGallus gallus (Chicken)9031UniRef100_P02457
UniRef90_P02457
1,453
Q9XSJ7CO1A1_CANLFCollagen alpha-1(I) chainCanis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_Q9XSJ7
UniRef90_Q9XSJ7
1,460
P11087CO1A1_MOUSECollagen alpha-1(I) chainMus musculus (Mouse)10090UniRef100_P11087
UniRef90_P11087
1,453
P02454CO1A1_RATCollagen alpha-1(I) chainRattus norvegicus (Rat)10116UniRef100_P02454
UniRef90_P11087
1,453
Q6LAN8Q6LAN8_HUMANCollagen type I alpha 1 (Fragment)Homo sapiens (Human)9606UniRef100_P02452
UniRef90_P02452
1,069
A0A4W2FAL4A0A4W2FAL4_BOBOXCollagen type I alpha 1 chainBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2FAL4
UniRef90_P02452
1,584
A0A4W2C021A0A4W2C021_BOBOXCollagen type I alpha 1 chainBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2C021
UniRef90_P02452
1,548
A0A4W2CI89A0A4W2CI89_BOBOXCollagen type I alpha 1 chainBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2CI89
UniRef90_P02452
1,533
A0A2K6S139A0A2K6S139_SAIBBCollagen type I alpha 1 chainSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6S139
UniRef90_P02452
1,464
A0A2K5PSE6A0A2K5PSE6_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5PSE6
UniRef90_P02452
1,464
A0A2K6D2Z5A0A2K6D2Z5_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6D2Z5
UniRef90_P02452
1,464
A0A2J8W8P8A0A2J8W8P8_PONABCOL1A1 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8W8P8
UniRef90_P02452
1,464
A0A2K6RPE8A0A2K6RPE8_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RPE8
UniRef90_P02452
1,464
A0A2K6M6Q3A0A2K6M6Q3_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6RPE8
UniRef90_P02452
1,464
A0A2K5J2F8A0A2K5J2F8_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K6RPE8
UniRef90_P02452
1,464
A0A2K6M6Q8A0A2K6M6Q8_RHIBEFibrillar collagen NC1 domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6RPE8
UniRef90_P02452
1,248
H9Z595H9Z595_MACMUCollagen alpha-1(I) chain preproproteinMacaca mulatta (Rhesus macaque)9544UniRef100_H9Z595
UniRef90_P02452
1,464
A0A2K5YYA9A0A2K5YYA9_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_H9Z595
UniRef90_P02452
1,464
A0A2K5WE66A0A2K5WE66_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_H9Z595
UniRef90_P02452
1,464
A0A0D9QYW4A0A0D9QYW4_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9QYW4
UniRef90_P02452
1,464
F6S739F6S739_CALJACollagen alpha-1(I) chain preproproteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F6S739
UniRef90_P02452
1,464
A0A2K5L756A0A2K5L756_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5L756
UniRef90_P02452
1,464
G3RBN8G3RBN8_GORGOCollagen type I alpha 1 chainGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RBN8
UniRef90_P02452
1,464

Sequence

Representative sequenceiLengthMass (Da)Tools
P02452

Checksumi: F0EC4DE778FFFC11

FASTA1,464138,942
        10         20         30         40         50
MFSFVDLRLL LLLAATALLT HGQEEGQVEG QDEDIPPITC VQNGLRYHDR
60 70 80 90 100
DVWKPEPCRI CVCDNGKVLC DDVICDETKN CPGAEVPEGE CCPVCPDGSE
110 120 130 140 150
SPTDQETTGV EGPKGDTGPR GPRGPAGPPG RDGIPGQPGL PGPPGPPGPP
160 170 180 190 200
GPPGLGGNFA PQLSYGYDEK STGGISVPGP MGPSGPRGLP GPPGAPGPQG
210 220 230 240 250
FQGPPGEPGE PGASGPMGPR GPPGPPGKNG DDGEAGKPGR PGERGPPGPQ
260 270 280 290 300
GARGLPGTAG LPGMKGHRGF SGLDGAKGDA GPAGPKGEPG SPGENGAPGQ
310 320 330 340 350
MGPRGLPGER GRPGAPGPAG ARGNDGATGA AGPPGPTGPA GPPGFPGAVG
360 370 380 390 400
AKGEAGPQGP RGSEGPQGVR GEPGPPGPAG AAGPAGNPGA DGQPGAKGAN
410 420 430 440 450
GAPGIAGAPG FPGARGPSGP QGPGGPPGPK GNSGEPGAPG SKGDTGAKGE
460 470 480 490 500
PGPVGVQGPP GPAGEEGKRG ARGEPGPTGL PGPPGERGGP GSRGFPGADG
510 520 530 540 550
VAGPKGPAGE RGSPGPAGPK GSPGEAGRPG EAGLPGAKGL TGSPGSPGPD
560 570 580 590 600
GKTGPPGPAG QDGRPGPPGP PGARGQAGVM GFPGPKGAAG EPGKAGERGV
610 620 630 640 650
PGPPGAVGPA GKDGEAGAQG PPGPAGPAGE RGEQGPAGSP GFQGLPGPAG
660 670 680 690 700
PPGEAGKPGE QGVPGDLGAP GPSGARGERG FPGERGVQGP PGPAGPRGAN
710 720 730 740 750
GAPGNDGAKG DAGAPGAPGS QGAPGLQGMP GERGAAGLPG PKGDRGDAGP
760 770 780 790 800
KGADGSPGKD GVRGLTGPIG PPGPAGAPGD KGESGPSGPA GPTGARGAPG
810 820 830 840 850
DRGEPGPPGP AGFAGPPGAD GQPGAKGEPG DAGAKGDAGP PGPAGPAGPP
860 870 880 890 900
GPIGNVGAPG AKGARGSAGP PGATGFPGAA GRVGPPGPSG NAGPPGPPGP
910 920 930 940 950
AGKEGGKGPR GETGPAGRPG EVGPPGPPGP AGEKGSPGAD GPAGAPGTPG
960 970 980 990 1000
PQGIAGQRGV VGLPGQRGER GFPGLPGPSG EPGKQGPSGA SGERGPPGPM
1010 1020 1030 1040 1050
GPPGLAGPPG ESGREGAPGA EGSPGRDGSP GAKGDRGETG PAGPPGAPGA
1060 1070 1080 1090 1100
PGAPGPVGPA GKSGDRGETG PAGPTGPVGP VGARGPAGPQ GPRGDKGETG
1110 1120 1130 1140 1150
EQGDRGIKGH RGFSGLQGPP GPPGSPGEQG PSGASGPAGP RGPPGSAGAP
1160 1170 1180 1190 1200
GKDGLNGLPG PIGPPGPRGR TGDAGPVGPP GPPGPPGPPG PPSAGFDFSF
1210 1220 1230 1240 1250
LPQPPQEKAH DGGRYYRADD ANVVRDRDLE VDTTLKSLSQ QIENIRSPEG
1260 1270 1280 1290 1300
SRKNPARTCR DLKMCHSDWK SGEYWIDPNQ GCNLDAIKVF CNMETGETCV
1310 1320 1330 1340 1350
YPTQPSVAQK NWYISKNPKD KRHVWFGESM TDGFQFEYGG QGSDPADVAI
1360 1370 1380 1390 1400
QLTFLRLMST EASQNITYHC KNSVAYMDQQ TGNLKKALLL QGSNEIEIRA
1410 1420 1430 1440 1450
EGNSRFTYSV TVDGCTSHTG AWGKTVIEYK TTKTSRLPII DVAPLDVGAP
1460
DQEFGFDVGP VCFL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again