Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P07437 Tubulin beta chain n=327 Tax=Eukaryota TaxID=2759 RepID=TBB5_HUMAN MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYV PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMM AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS EYQQYQDATAEEEEDFGEEAEEEA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 327  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P07437TBB5_HUMANTubulin beta chainHomo sapiens (Human)9606UniRef100_P07437
UniRef90_P07437
444Representative
Q2KJD0TBB5_BOVINTubulin beta-5 chainBos taurus (Bovine)9913UniRef100_P07437
UniRef90_P07437
444
P69893TBB5_CRIGRTubulin beta-5 chainCricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef100_P07437
UniRef90_P07437
444
P69895TBB5_MACMUTubulin beta chainMacaca mulatta (Rhesus macaque)9544UniRef100_P07437
UniRef90_P07437
444
P99024TBB5_MOUSETubulin beta-5 chainMus musculus (Mouse)10090UniRef100_P07437
UniRef90_P07437
444
Q7JJU6TBB5_PANTRTubulin beta chainPan troglodytes (Chimpanzee)9598UniRef100_P07437
UniRef90_P07437
444
Q767L7TBB5_PIGTubulin beta chainSus scrofa (Pig)9823UniRef100_P07437
UniRef90_P07437
444
Q5R943TBB5_PONABTubulin beta chainPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P07437
UniRef90_P07437
444
P69897TBB5_RATTubulin beta-5 chainRattus norvegicus (Rat)10116UniRef100_P07437
UniRef90_P07437
444
P09244TBB7_CHICKTubulin beta-7 chainGallus gallus (Chicken)9031UniRef100_P07437
UniRef90_P07437
444
Q6P9T8TBB4B_RATTubulin beta-4B chainRattus norvegicus (Rat)10116UniRef100_Q6P9T8
UniRef90_Q6P9T8
445
P41387TBB_ONCGITubulin beta chainOnchocerca gibsoni6284UniRef100_P41387
UniRef90_P41387
444
A0A402FT73A0A402FT73_9SAURTubulin beta chainParoedura picta143630UniRef100_P07437
UniRef90_P07437
464
Q5SU16Q5SU16_HUMANTubulin beta chainHomo sapiens (Human)9606UniRef100_P07437
UniRef90_P07437
444
A0A0P6CCV0A0A0P6CCV0_9CRUSTubulin beta chainDaphnia magna35525UniRef100_P07437
UniRef90_P07437
444
Q5TM69Q5TM69_MACMUTubulin beta chainMacaca mulatta (Rhesus macaque)9544UniRef100_P07437
UniRef90_P07437
444
U3FM57U3FM57_CALJATubulin beta chainCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_P07437
UniRef90_P07437
444
A0A384C9R0A0A384C9R0_URSMATubulin beta chainUrsus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_P07437
UniRef90_P07437
444
A0A480TK33A0A480TK33_PIGTubulin beta chainSus scrofa (Pig)9823UniRef100_P07437
UniRef90_P07437
444
A0A4W2C297A0A4W2C297_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_P07437
UniRef90_P07437
444
A0A3Q7XKN1A0A3Q7XKN1_URSARTubulin beta chainUrsus arctos horribilis116960UniRef100_P07437
UniRef90_P07437
444
A0A452SPC5A0A452SPC5_URSAMTubulin beta chainUrsus americanus (American black bear) (Euarctos americanus)9643UniRef100_P07437
UniRef90_P07437
444
S9WJD1S9WJD1_CAMFRTubulin beta chainCamelus ferus (Wild bactrian camel) (Camelus bactrianus ferus)419612UniRef100_P07437
UniRef90_P07437
444
A0A4X2JR93A0A4X2JR93_VOMURUncharacterized proteinVombatus ursinus (Common wombat)29139UniRef100_P07437
UniRef90_P07437
444
A0A2K6G5S3A0A2K6G5S3_PROCOTubulin beta chainPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_P07437
UniRef90_P07437
444

Sequence

Representative sequenceiLengthMass (Da)Tools
P07437

Checksumi: 1E6CD0A36773A103

FASTA44449,671
        10         20         30         40         50
MREIVHIQAG QCGNQIGAKF WEVISDEHGI DPTGTYHGDS DLQLDRISVY
60 70 80 90 100
YNEATGGKYV PRAILVDLEP GTMDSVRSGP FGQIFRPDNF VFGQSGAGNN
110 120 130 140 150
WAKGHYTEGA ELVDSVLDVV RKEAESCDCL QGFQLTHSLG GGTGSGMGTL
160 170 180 190 200
LISKIREEYP DRIMNTFSVV PSPKVSDTVV EPYNATLSVH QLVENTDETY
210 220 230 240 250
CIDNEALYDI CFRTLKLTTP TYGDLNHLVS ATMSGVTTCL RFPGQLNADL
260 270 280 290 300
RKLAVNMVPF PRLHFFMPGF APLTSRGSQQ YRALTVPELT QQVFDAKNMM
310 320 330 340 350
AACDPRHGRY LTVAAVFRGR MSMKEVDEQM LNVQNKNSSY FVEWIPNNVK
360 370 380 390 400
TAVCDIPPRG LKMAVTFIGN STAIQELFKR ISEQFTAMFR RKAFLHWYTG
410 420 430 440
EGMDEMEFTE AESNMNDLVS EYQQYQDATA EEEEDFGEEA EEEA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again