Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P10644 cAMP-dependent protein kinase type I-alpha regulatory subunit n=689 Tax=Bilateria TaxID=33213 RepID=KAP0_HUMAN MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG PCSDILKRNIQQYNSFVSLSV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 689  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P10644KAP0_HUMANcAMP-dependent protein kinase type I-alpha regulatory subunitHomo sapiens (Human)9606UniRef100_P10644
UniRef90_P10644
381Representative
Q5REL1KAP0_PONABcAMP-dependent protein kinase type I-alpha regulatory subunitPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P10644
UniRef90_P10644
381
B2R5T5B2R5T5_HUMANEpididymis secretory sperm binding proteinHomo sapiens (Human)9606UniRef100_P10644
UniRef90_P10644
381
H2R3M7H2R3M7_PANTRPRKAR1A isoform 12Pan troglodytes (Chimpanzee)9598UniRef100_P10644
UniRef90_P10644
381
A0A2J8V090A0A2J8V090_PONABPRKAR1A isoform 16Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P10644
UniRef90_P10644
381
A0A2R9AQD9A0A2R9AQD9_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_P10644
UniRef90_P10644
381
A0A2I3HG51A0A2I3HG51_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_P10644
UniRef90_P10644
381
K7EPB2K7EPB2_HUMANcAMP-dependent protein kinase type I-alpha regulatory subunit (Fragment)Homo sapiens (Human)9606UniRef100_P10644
UniRef90_P10644
297
A0A2J8V091A0A2J8V091_PONABPRKAR1A isoform 13 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P10644
UniRef90_P10644
297
A0A2J8KKN0A0A2J8KKN0_PANTRPRKAR1A isoform 13 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_P10644
UniRef90_P10644
297
A0A3Q3IMK2A0A3Q3IMK2_MONALUncharacterized proteinMonopterus albus (Swamp eel)43700UniRef100_A0A3Q3IMK2
UniRef90_P10644
457
A0A3P8UJ75A0A3P8UJ75_CYNSEUncharacterized proteinCynoglossus semilaevis (Tongue sole)244447UniRef100_A0A3Q3IMK2
UniRef90_P10644
257
A0A3S2MHT2A0A3S2MHT2_ORYJAUncharacterized proteinOryzias javanicus (Javanese ricefish) (Aplocheilus javanicus)123683UniRef100_A0A3S2MHT2
UniRef90_P10644
455
A0A3B3BI81A0A3B3BI81_ORYMEUncharacterized proteinOryzias melastigma (Marine medaka)30732UniRef100_A0A3S2MHT2
UniRef90_P10644
380
A0A1S3S025A0A1S3S025_SALSAcAMP-dependent protein kinase type I-alpha regulatory subunit-like isoform X1Salmo salar (Atlantic salmon)8030UniRef100_A0A1S3S025
UniRef90_P10644
393
A0A1S3S0P0A0A1S3S0P0_SALSAcAMP-dependent protein kinase type I-alpha regulatory subunit-like isoform X1Salmo salar (Atlantic salmon)8030UniRef100_A0A1S3S0P0
UniRef90_P10644
393
V9KME9V9KME9_CALMIcAMP-dependent protein kinase, regulatory subunit alpha 1Callorhinchus milii (Ghost shark)7868UniRef100_V9KME9
UniRef90_P10644
388
A0A401S4A8A0A401S4A8_CHIPUUncharacterized protein (Fragment)Chiloscyllium punctatum (Brownbanded bambooshark) (Hemiscyllium punctatum)137246UniRef100_V9KME9
UniRef90_P10644
214
A0A098M1D8A0A098M1D8_9SAURcAMP-dependent protein kinase type I-alpha regulatory subunit-like proteinHypsiglena sp. JMG-20141550645UniRef100_A0A098M1D8
UniRef90_P10644
382
A0A2I0M742A0A2I0M742_COLLIProtein kinase, cAMP-dependent, regulatory, type I, alpha, transcript variant X1Columba livia (Rock dove)8932UniRef100_A0A2I0M742
UniRef90_P10644
382
A0A1V4KVP4A0A1V4KVP4_PATFAcAMP-dependent protein kinase type I-alpha regulatory subunitPatagioenas fasciata monilis372326UniRef100_A0A2I0M742
UniRef90_P10644
382
T1DM29T1DM29_CROHDcAMP-dependent protein kinase type I-alpha regulatory subunit-like proteinCrotalus horridus (Timber rattlesnake)35024UniRef100_T1DM29
UniRef90_P10644
382
J3SE38J3SE38_CROADcAMP-dependent protein kinase type I-alpha regulatory subunit-like proteinCrotalus adamanteus (Eastern diamondback rattlesnake)8729UniRef100_T1DM29
UniRef90_P10644
382
A0A1W7RIQ8A0A1W7RIQ8_AGKCOcAMP-dependent protein kinase type I-alpha regulatory subunit-like proteinAgkistrodon contortrix contortrix (Southern copperhead)8713UniRef100_T1DM29
UniRef90_P10644
382
A0A0Q3UTD6A0A0Q3UTD6_AMAAEcAMP-dependent protein kinase type I-alpha regulatory subunitAmazona aestiva (Blue-fronted Amazon parrot)12930UniRef100_A0A0Q3UTD6
UniRef90_P10644
382

Sequence

Representative sequenceiLengthMass (Da)Tools
P10644

Checksumi: 2D04F08CE8857A6D

FASTA38142,982
        10         20         30         40         50
MESGSTAASE EARSLRECEL YVQKHNIQAL LKDSIVQLCT ARPERPMAFL
60 70 80 90 100
REYFERLEKE EAKQIQNLQK AGTRTDSRED EISPPPPNPV VKGRRRRGAI
110 120 130 140 150
SAEVYTEEDA ASYVRKVIPK DYKTMAALAK AIEKNVLFSH LDDNERSDIF
160 170 180 190 200
DAMFSVSFIA GETVIQQGDE GDNFYVIDQG ETDVYVNNEW ATSVGEGGSF
210 220 230 240 250
GELALIYGTP RAATVKAKTN VKLWGIDRDS YRRILMGSTL RKRKMYEEFL
260 270 280 290 300
SKVSILESLD KWERLTVADA LEPVQFEDGQ KIVVQGEPGD EFFIILEGSA
310 320 330 340 350
AVLQRRSENE EFVEVGRLGP SDYFGEIALL MNRPRAATVV ARGPLKCVKL
360 370 380
DRPRFERVLG PCSDILKRNI QQYNSFVSLS V
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again